(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE359

CAGLA1_12.PE359      Location/Qualifiers
FT   CDS_pept        complement(823019..824884)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439014"
FT                   /locus_tag="CAGL0M08272g"
FT                   /product="Similar to uniprot|P36029 Saccharomyces
FT                   cerevisiae YKL174c"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62681.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG146321"
FT                   /db_xref="HOGENOM:HBG202405"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00003B713F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ89"
FT                   /transl_table=1
FT                   /translation="MIQEYTLIPENIRENIRENMPNLDPHEIFENLHHYVQEDEVTDEP
FT                   EEVEHFNYKQELDKSLLSRNSVIGLGFGLMSPVLGMCTSMGIGMLNGGPLSIMLGFFIS
FT                   GILIWFSSLSLGEIVSKFPMELHVGSAMIAPPRLKLICSWFTGWLMLIGNWTMSTSITF
FT                   AGAQLTISLILMANNELISETHLILFTVIVFYMVVTLVGLVNLKFARFIEIINKVCVYW
FT                   IIYAIIFIDILLLIFHKGKFRSLKYALFHFDNSMSGYSSAFLSFLIGFQQSNFTLQGFS
FT                   MLPALADEVKKPEKDIPRGMSTAVLLSTFSGLIFLLPIMLILPDIETIFSNHKVLPIVT
FT                   IFTKSTHSMVVSVFLVLLILGNLFFSGIGSITTSSRAVYSFSRDHAIPRYDLWTFVPPD
FT                   SQSRVPKYSILLSMGISYFLGLLALISTAAFNAFIGAAVLCLCSATFIPLVLVLCTGRR
FT                   SIKHAPVKIRYKFGWFINIASVLWLLLVMVSVCFPTQLPVTVKGMNYAIVVYVLCLIGI
FT                   TILYFKWGKYNFRLPLSDDAKNNPFSLEAQFPTTKEDNEYEHSGSNAKTANLPEGQASP
FT                   VENPFIGEHENSQTDIDFDVVSVDLQDAIEERDTRLEGQTRNDTN"
     atgatacagg aatatacttt gatcccggag aatatccggg agaatatccg tgaaaatatg        60
     cctaacttgg atcctcatga aatatttgaa aatttacacc actatgttca agaggatgaa       120
     gttaccgatg aacccgagga agtagaacat ttcaattata aacaagaact agataagtcc       180
     ctgctgtcac ggaactctgt gataggttta gggtttggct taatgagtcc cgtactgggt       240
     atgtgcacta gtatgggtat tggtatgctt aatggtgggc ccttgtccat catgcttggg       300
     ttttttatta gcggaatact aatatggttc tcatccttat ctcttggaga gattgtttca       360
     aagtttccaa tggagttgca tgttgggagt gctatgattg caccacctcg tctaaaactg       420
     atctgctctt ggtttactgg ctggctaatg ttgatcggta actggacgat gagtacaagc       480
     ataacattcg ccggcgccca gctaactata tcattaatat tgatggccaa caacgaatta       540
     atatcagaga cacatcttat tctattcact gtgattgtgt tctacatggt agttactcta       600
     gtgggccttg ttaacttaaa gtttgcaaga ttcatcgaga taatcaacaa agtttgtgtt       660
     tattggatta tctatgccat cattttcatt gatattttgc ttcttatttt tcacaagggt       720
     aaatttagat cattgaagta cgctttattt cattttgaca atagcatgtc cggatattct       780
     agtgcattcc tttcatttct aattggtttt caacaatcta actttacatt acaagggttt       840
     agtatgcttc cagctttagc tgacgaagtt aaaaaacctg aaaaagatat cccaaggggt       900
     atgtcaaccg ctgtcttgct ttcaacgttc tccggcctaa tattcttact tcctatcatg       960
     ttaatcctac cggatatcga gaccatattt tcaaatcata aggtactccc aattgtaact      1020
     atattcacaa aatctacaca ttcgatggtg gtttccgtat tcttggtcct tttgatttta      1080
     ggtaacttat ttttctctgg gattggctcc atcacaacat cttctcgtgc tgtttatagt      1140
     tttagtcgtg atcatgccat tccacgttat gatttatgga cttttgttcc tcctgactcc      1200
     cagtcaagag ttccaaaata ttctatctta ttgagtatgg gaatatcata ctttctaggt      1260
     ttactagcac taatctcaac agccgctttt aacgctttta tcggtgcagc tgtgctatgt      1320
     ctatgttctg caacattcat tccattggta ttagtcttat gcactggaag aagatcaata      1380
     aaacacgcac ctgtaaaaat acgatacaaa tttggttggt tcatcaacat tgcttctgta      1440
     ctgtggctat tattagtaat ggttagcgta tgctttccaa ctcaacttcc tgtcacagta      1500
     aaaggcatga attacgccat cgtagtttat gttttatgct taataggtat aactatcctt      1560
     tatttcaaat ggggtaaata caattttaga ttacctcttt cagatgatgc gaagaataac      1620
     ccttttagtt tggaagcgca attcccaaca acaaaagaag ataacgaata cgaacatagt      1680
     ggttcgaatg ccaaaactgc aaatctacca gaaggacaag caagcccagt cgagaatcca      1740
     tttattgggg aacatgaaaa tagccaaaca gatattgatt ttgatgttgt atcagttgat      1800
     ctacaagatg caatagagga aagagatact aggttagagg gccaaactag aaatgatacg      1860
     aactga                                                                 1866
//

If you have problems or comments...

PBIL Back to PBIL home page