(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE36

CAGLA1_12.PE36       Location/Qualifiers
FT   CDS_pept        complement(97304..98599)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000020206" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436694"
FT                   /locus_tag="CAGL0M00880g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /protein_id="CAG62360.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG408326"
FT                   /db_xref="HOGENOM:HBG725944"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00003B7003"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK60"
FT                   /transl_table=1
FT                   /translation="MNFNISSKETVELEQKYSAHNYHPLPVVFHKASGAHVWDPEGKEY
FT                   LDFLSAYSAVNQGHCHPKIVKALVDQASTLTLSSRAFSNDVFAVFAKYVTEYFGYEMVL
FT                   PMNTGAEAVETALKLARRWGYEVKKIPDNEAIVLGAQGNFHGRTFGAISLSTDEEDSRK
FT                   HFGPFLTNTTAKNPSKGQAIRYGHIEDLEQAFESHGDKIAAVILEPIQGEAGIVVPPKG
FT                   YLLDVQNLCKKYNSLFICDEIQTGIGRTGKLLCFEHTEGVKPDVVLLGKAISGGVLPVS
FT                   CVLSSREIMSCFTPGSHGSTFGGNPMASRVAIAALDVIKEEKLVERAQKLGDLLQDELR
FT                   KLQAQSDGMISEVRGVGLLTAIVIDSQKAQGRTAWDLCLLMKDKGVLAKPTHDHIIRLA
FT                   PPLVISEEDLLKGVQAMKEALVELPSAPISGH"
     atgaacttta acattagctc caaggaaact gttgaactag aacagaaata ctctgcgcac        60
     aactaccacc ctctgcctgt ggtgttccac aaggcgtctg gtgctcacgt ttgggaccct       120
     gaggggaagg agtacttgga ttttctgagt gcttactctg ctgtgaacca aggtcattgt       180
     cacccaaaga tcgtcaaggc actagtcgac caagcatcga ctctaactct gtcatctaga       240
     gcgttctcca acgatgtgtt tgccgttttc gcaaagtacg taactgaata tttcggctat       300
     gagatggtgt tgccaatgaa cactggtgct gaagctgtag aaaccgcttt gaaattggca       360
     agaaggtggg gttacgaagt caagaagatt ccagacaacg aggccattgt tcttggtgcg       420
     caaggtaact tccatggtag aacatttggt gcaatctctt tgtctactga tgaggaagac       480
     tccagaaagc actttggtcc atttttgaca aacacaactg ccaagaaccc atcaaaggga       540
     caggcaatta gatatggcca tatcgaggac ttggaacagg cttttgagtc tcatggtgac       600
     aagattgccg cagtgatcct tgaacctatt caaggtgaag ctggtattgt tgtgccacca       660
     aagggctacc tattggatgt ccaaaacttg tgtaaaaaat acaactctct tttcatctgt       720
     gatgaaattc aaactggtat cggtagaact ggtaagttgc tatgttttga gcatactgaa       780
     ggtgtaaaac ctgatgtagt tctgttgggt aaagccattt ctggtggtgt tttgccagtg       840
     tcttgtgtgc tgtcatctcg tgaaatcatg tcctgcttta caccgggctc ccatggttcc       900
     acttttggtg gtaacccaat ggcctcaaga gttgcaattg ccgctcttga tgtcatcaag       960
     gaagagaaat tggttgagag agctcaaaaa ctcggagatc tactacaaga tgaactacgt      1020
     aaacttcaag cacagtcaga cggtatgatt tccgaagtaa gaggtgtagg tttactaact      1080
     gccattgtca ttgactcaca aaaggcccaa ggccgtacag catgggacct atgtctatta      1140
     atgaaagaca aaggtgtcct agccaagcca acgcacgacc acataattag attggctcca      1200
     ccattggtca tctcagagga ggacttgttg aagggtgttc aagctatgaa agaagcattg      1260
     gtagaactac caagtgctcc aattagcggt cattag                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page