(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE360

CAGLA1_12.PE360      Location/Qualifiers
FT   CDS_pept        825250..828219
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231589" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440073"
FT                   /locus_tag="CAGL0M08294g"
FT                   /product="Similar to uniprot|P36048 Saccharomyces
FT                   cerevisiae YKL173w U5 snRNP-specific protein "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="CAG62682.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG156268"
FT                   /db_xref="HOGENOM:HBG737692"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00003B7140"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ88"
FT                   /transl_table=1
FT                   /translation="MDFDEFGNPIGDELELGEEIEVKKEETESIGTNGEGSNHSDNEIN
FT                   EEDDDYMSDLDADFDDENLALESLRHTYGDQVEVLMEYEDRDANEPIVESGDTGESHSK
FT                   EGVFIRLKKNIPRAQFDREYMMQMMKVPERIRTVCILGPLHSGKTSIADIFVLNNYDRL
FT                   NCITKNIRLGWKQLRYMDNTRQEIERGMTLKLNGMTFLATDMQDKSHVINLLDTPGHVD
FT                   FIDEVAVAMSVSDTALVCIDIIEGISSTTRYIIKECQKRGLSMVFLINKIDRLVLELML
FT                   PPTEAYMKLQELVLNIQGATKDSMFTPENNNILFASAKFGIIFSIEQFVSKCYGKVLAG
FT                   PKLNEFVKRVWRNNYYDRGVFHPRTLNDKNHEATFVTFILNPIYKIFTHTLSREVDVVS
FT                   KTLKKNFGVSLTEDEMANDPQPLLKVVFTKIFPDQKALISSLTSCSGSGNYYQKQVNLL
FT                   ENGVQNTSSRQFLAHAVKNMSIGDSEWTLVKVYHGNIAVGDKISVIVPVSNISDSGVKF
FT                   IDEEMLEEGSQHVIEAISLLGGRFCYPVPSASEGQLVLLKGISKSFVKSATLCSNNIES
FT                   AGLPLFQAINYIGRPVFKVIIAPLNPKELPKLLSGLEKTNRYYPGLHVKVEESGEHVLL
FT                   GNGELYFDCLMHDLRNVYGGIEVKISDPVTVFAESCQGESFAAIPVESSNHNISLTVCA
FT                   EPLDKKIVQDISKKKLDVELLGDKKGLREMAKVLRRDYGWDSLAARNIWAFFHTSILVD
FT                   DTLPDETDKNLLQHFREQVLQGFYWAVREGPLMEEAIHGVKFRILKFEMSGRVNLDSLD
FT                   VGIIGVQLIPLMRKACNVALLTAKPIVVEPIYEMDIIMKKVYYPVLEEVLKKRRSAYIY
FT                   ATETIPGTPLIEVKTQVPVIESFGLETDIRLSSEGNAIIQSHQWNDIWRKVPGDVMDED
FT                   APIPKLKPAPTSSLSRDFVMKTRRRKGISNDGFMSNDGPTLQKYIDKELFSQLKEAGFV
FT                   "
     atggattttg acgagtttgg taatcccatt ggtgatgagt tggaactggg ggaagaaatt        60
     gaggttaaga aagaagagac cgagagcata ggtaccaatg gtgaaggaag caatcatagt       120
     gataatgaga taaacgagga agatgacgat tatatgagtg atctagatgc cgattttgac       180
     gacgagaacc tcgctttaga gtctcttaga catacttatg gtgatcaagt tgaagtgctg       240
     atggaatatg aagatagaga cgcaaatgag cctattgtcg aaagtggtga tactggggaa       300
     tctcacagca aagagggtgt ttttattaga ttaaaaaaga atattcctag ggcgcaattt       360
     gatagagagt atatgatgca gatgatgaaa gtgccagaaa gaatacgaac tgtatgcatt       420
     ttaggaccct tacattcggg taagacatca attgccgaca tattcgtact taacaattat       480
     gatagactga actgcattac taaaaatatt agacttggtt ggaagcaatt gcgttatatg       540
     gataatacta gacaagaaat agaaagagga atgactttga agctaaatgg aatgactttc       600
     cttgctacag atatgcaaga taagtcacat gttataaatt tactggatac acccgggcat       660
     gtggatttta ttgatgaggt agctgtggca atgtctgttt cggatactgc actagtgtgt       720
     atcgatatca tcgaaggcat tagctccact acacggtata taatcaaaga atgtcaaaag       780
     aggggactat caatggtatt cttgattaac aagattgatc gactggtact tgaacttatg       840
     ttaccgccta ctgaggcata catgaaactg caggagcttg tgttgaatat ccaaggagct       900
     acaaaagata gcatgtttac accagaaaat aataatattt tatttgcatc cgccaaattt       960
     gggataattt tctcaataga acaatttgta tcgaaatgtt atggtaaggt tctggctggt      1020
     ccaaaactga atgaatttgt caaaagagtt tggaggaata actactacga tagaggcgtt      1080
     ttccacccaa gaacactaaa tgataaaaac catgaagcga catttgtaac ttttatcttg      1140
     aacccaatct acaagatatt tactcacaca ttatcaaggg aagtggatgt ggtatctaaa      1200
     acactcaaga aaaactttgg ggtatcactt actgaggatg aaatggccaa tgatccgcaa      1260
     cctttattaa aggtagtatt cactaagata tttccagacc aaaaggcttt aatctcttct      1320
     ttaacttcat gttctggctc aggtaattat tatcaaaaac aagtgaatct attagaaaat      1380
     ggggtacaga atacatcttc cagacaattt ttagcacatg cagtcaaaaa catgagtata      1440
     ggagacagtg agtggacctt ggtaaaagta tatcatggaa atattgctgt aggagacaaa      1500
     atttcagtaa ttgtccccgt tagtaatata tctgactctg gagtgaagtt tattgatgaa      1560
     gaaatgttag aagaaggatc gcagcatgtc attgaagcga tttccttgtt gggcggtagg      1620
     ttttgctacc ctgttccatc agcttctgaa gggcaactag tcttgttaaa aggtatctct      1680
     aaaagttttg tcaaatctgc taccttgtgt agcaacaata tagaatctgc tggtctaccg      1740
     ttatttcaag ctataaatta cataggtagg cctgtattca aagttatcat cgcaccactt      1800
     aatccaaagg aattaccaaa actactgagt ggtctggaaa aaactaatag atactatccc      1860
     ggattacacg tcaaagtgga ggagtctgga gagcatgttt tgctaggtaa tggtgaactt      1920
     tattttgatt gcttaatgca tgatttaagg aatgtttatg gtggaattga ggttaaaatc      1980
     tcggatccag ttactgtatt tgctgaaagt tgtcaagggg agtcatttgc ggccataccg      2040
     gtggagtctt ctaatcacaa tatatcgcta acagtttgtg cagagccttt ggacaagaag      2100
     attgttcaag atataagtaa gaagaaactt gatgtagaac ttctaggaga taagaagggt      2160
     ttaagagaga tggctaaggt tcttagacgg gattacggat gggattcttt agcggcaaga      2220
     aacatatggg cgttttttca cacttcgata cttgtagatg atacgttacc tgacgaaact      2280
     gacaagaatc ttttacagca tttcagagaa caggtcttgc aagggttcta ttgggctgtt      2340
     cgcgaagggc ccttgatgga agaagctatc catggagtta aatttcggat tttgaagttt      2400
     gaaatgagcg ggcgtgttaa tttggactct ttggatgttg gtataattgg tgtacaattg      2460
     attccactaa tgagaaaagc atgtaatgtg gccttactca ctgctaaacc tattgtagtg      2520
     gagccaatct atgaaatgga cattattatg aaaaaagtgt attaccccgt tttggaagaa      2580
     gtgctaaaga aacgcagaag tgcctatatt tatgcaacgg agaccattcc aggtacacct      2640
     ttgatagaag tgaaaaccca ggtacctgta atcgagtctt ttggtctcga gacagatatc      2700
     aggctatcct ccgagggcaa tgcgatcatc caatcacatc aatggaatga catctggaga      2760
     aaagtcccag gtgatgtaat ggatgaagat gcacctatcc ctaagctgaa accagcgcca      2820
     acctccagtt tgagtagaga ttttgtaatg aagaccagac gccgtaaagg gatatccaac      2880
     gatggattca tgtccaatga tgggcccacc ttacagaaat acattgataa agaactcttt      2940
     tcccaactta aggaagcggg atttgtatag                                       2970
//

If you have problems or comments...

PBIL Back to PBIL home page