(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE361

CAGLA1_12.PE361      Location/Qualifiers
FT   CDS_pept        829069..831963
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113231" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045129"
FT                   /locus_tag="CAGL0M08316g"
FT                   /product="Similar to uniprot|P36003 Saccharomyces
FT                   cerevisiae YKL171w"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG62683.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058976"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016241"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B7141"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ87"
FT                   /transl_table=1
FT                   /translation="MYGQRRVRSERYSSDISSGKDEEIKVSRSKGIDCPPRRRESSTNE
FT                   DSLYFQPTKIYKLEKELASRSTLVKSDKDSTDEERDSDEIVSNRFNEADSVRHFGRYTD
FT                   ENYQYRHINGLVPDYYEGMRKNKLGLVSDLTNESRNNYIFEQNANFEMEFPIDESALGG
FT                   NETRGMHDEYIPNLNYGQLIENWVDEEKQVQTMEDLQREDSMLQGQLMKEASMILSNKV
FT                   RSPTQERSQTPRLATWVNDYDSEPRIMTNRSSSVIPEALSDDDIREDSLSPNTSAIFSN
FT                   SHAQVEPIPLPSKNSSRMPTSTLEDRRSYMNFLGKPASTFGAIDSMGMSALKNVNSFLP
FT                   IHKSSLPSTIPVRKGSSGQSTANSDSSSLNLQHNLSSSVGDLKLDSDQMMDLIRKLPKD
FT                   FLTLPYSQRKKQIIKLAPDKDSRLIMSLLKKVMITNSKSASSIQKPSMRSRHGSLASQF
FT                   LSSFSPSVASMASSGGFRPDDKGLFIMGHKLGKVIGFGAWGMIRECVDIQSGAQRAMKI
FT                   VRFKDNQKVKRNVIREVNVWKEMHHMYILPLLDWKLISDYAMYCLTERVKDGTLYDLVL
FT                   SWEDRKNNQIPVDERIKLTMFLMLQLISALKYMHSNSTVHGDIKLENCLLKKGRQHKNW
FT                   TIFLCDFGMSCRFGSYRSRYDTLIDEEKNNSGIIREESYMPLSFEASPKPIYREVSQLN
FT                   SQHSQLSSQLTPQLQLQSNSASFSQPQQFLAVQQLPQPEPSLPHVHSDSNSTSQPPSKF
FT                   MKIVTDRNVIHDDTPFEILTARQASRRSFESHNSKKSQKMSTVSVESLPSSPSATPLDN
FT                   VNAFDPCSLDAQRHFSLSVENSNTKTPSSLIGSLPYAAPELLVPEPSPLGPGADIWALG
FT                   VTMYTMLMGKLPFKHDLESKLKQLIASGKFDKKSLKCMCNGGHSNLSDEALKYQGLYDA
FT                   ILGCLTINLLDRWGLHDVETALREELKKNGELSQ"
     atgtacggtc aacggagagt acggtcggaa aggtattcaa gcgatatatc aagtggcaag        60
     gatgaagaaa taaaagttag tagaagtaaa ggaattgact gtccccccag gaggagggaa       120
     agtagtacaa atgaggattc tctatacttt cagcccacaa agatttacaa actggaaaag       180
     gagctggctt ctagaagtac ccttgtaaaa tcggataaag actctacaga tgaagaaaga       240
     gattcggatg aaatagtttc aaacagattt aatgaagcag attcagtacg gcattttggt       300
     agatataccg atgaaaatta tcaatatcga catattaatg gtcttgtacc tgattattat       360
     gagggcatga gaaaaaataa actgggccta gtttcggatc tcactaatga atcaagaaat       420
     aattatattt tcgaacaaaa tgctaacttt gaaatggaat tcccgattga tgaatctgct       480
     cttggtggta atgaaacgag aggcatgcac gatgaatata tacccaactt gaattatggt       540
     cagttgatag aaaattgggt ggatgaagaa aagcaagtac aaacaatgga agatttacaa       600
     agagaagata gtatgttaca aggccagttg atgaaggaag catctatgat tctttcaaat       660
     aaagttagat ctccaacgca agaaagaagt caaacaccca gattagcgac atgggtaaac       720
     gattatgata gtgagccacg tataatgaca aatagaagtt catcagttat tcctgaggca       780
     ttatctgacg atgatattag agaagatagt ttaagtccta atacatccgc aatttttagt       840
     aattcgcatg ctcaggttga gcctatacca ctcccaagta aaaactcatc aagaatgcct       900
     acatcaacat tggaggatag gcgatcgtac atgaactttc ttggaaaacc agcgtcgact       960
     tttggtgcta ttgatagcat gggtatgtca gcccttaaga atgtgaatag ttttcttcct      1020
     attcataaat catcactacc atcaacaata cctgtaagaa agggatcatc tggtcaatct      1080
     accgcaaatt ccgattcatc atcactaaat ttacagcata acttgagttc atctgttggt      1140
     gatttaaaat tagactctga ccagatgatg gacttaatta ggaaactacc aaaggacttt      1200
     ctaacattac catactcaca gaggaagaag cagataataa aacttgcccc cgataaggat      1260
     tcaagactta tcatgtcctt gttaaaaaag gtaatgatca caaattctaa gagtgcgtcc      1320
     tcgattcaaa agccaagtat gcggtccaga catgggtcat tggcatcaca gttcttgagt      1380
     tcattttctc cttctgtggc atcaatggct agtagtggag ggtttcgacc tgatgacaaa      1440
     gggttgttta ttatgggaca caaattagga aaagttattg gcttcggtgc atggggtatg      1500
     ataagagaat gcgttgacat acaatctgga gcacaaagag caatgaaaat tgtaagattc      1560
     aaagataacc aaaaggtgaa gagaaatgtc atcagggagg ttaatgtttg gaaagaaatg      1620
     catcatatgt atatattgcc tttattggat tggaaattga tcagtgatta tgccatgtat      1680
     tgtttaacag aaagagtaaa agatggtaca ttatatgatt tagtgctttc atgggaggat      1740
     agaaagaata atcagatccc ggtagatgaa aggattaagt tgactatgtt cctgatgttg      1800
     cagctaatat cagctctaaa atatatgcat tcaaactcca cggttcatgg tgatatcaag      1860
     cttgaaaatt gtttactgaa gaaaggtaga caacataaaa attggacaat tttcttatgt      1920
     gattttggta tgagctgcag atttggttct taccgtagtc ggtatgatac cttaatagat      1980
     gaggagaaga acaactcagg aattatcaga gaggaatcat atatgccgct ttcatttgag      2040
     gcttcgccaa agcctatcta tagggaggtt tctcaattaa attctcaaca ttcgcaattg      2100
     agttcgcaat taactcctca attacaactt cagtcaaatt ctgcatcgtt ttcacagccg      2160
     caacaatttc tggctgtaca gcaactgcca cagccagagc catcattgcc acatgtgcat      2220
     tcggattcta acagcacttc tcaacctcca tctaaattca tgaagattgt gactgacaga      2280
     aatgttattc atgatgacac tccatttgaa atcctcacag ctaggcaggc gtcaaggaga      2340
     tcttttgaat ctcacaatag taaaaagtcc cagaaaatga gcacagtatc agttgaatcg      2400
     cttccatctt caccctcagc aactcctctt gataatgtga atgcattcga tccttgttct      2460
     ttggatgctc aaaggcattt ctctctgtcg gttgagaatt ctaacacaaa gacaccatca      2520
     tctctaattg ggtctctacc atatgctgca cctgaattat tggtacctga gccttctccg      2580
     ttggggcctg gtgcagatat ttgggcattg ggtgttacta tgtacacaat gcttatgggt      2640
     aagctaccct tcaagcatga cttagaatcc aaacttaaac aattgatagc atcaggaaag      2700
     tttgacaaga aatctctaaa atgtatgtgt aatggtgggc acagtaatct ctcggatgag      2760
     gctcttaaat atcaaggatt gtatgacgct attcttgggt gcttgacgat caacctcctt      2820
     gatcgttggg gactgcatga tgttgaaaca gcactcagag aagaattaaa gaaaaatgga      2880
     gaactaagcc agtag                                                       2895
//

If you have problems or comments...

PBIL Back to PBIL home page