(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE363

CAGLA1_12.PE363      Location/Qualifiers
FT   CDS_pept        complement(833220..835520)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000112846" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440075"
FT                   /gene_name="KKQ8"
FT                   /locus_tag="CAGL0M08360g"
FT                   /product="Probable serine/threonine-protein kinase KKQ8 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG62685.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG124951"
FT                   /db_xref="HOGENOM:HBG202407"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI00003B7143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ85"
FT                   /transl_table=1
FT                   /translation="MPEHEERHSHGVNRSLSLGSSMRSLFKSQRSRGPSDRGANGTPGP
FT                   AQKVDIRVDTASASREHTPVVHKTPQSANPELQQPRHHLGLPNILKLNLTPTNSNPQSK
FT                   SGSPVSQNTSQESLITDTDIEVEDYRPSKDSRRTVRNASPMSSNGNLPINANTVIGPDT
FT                   SSNNIDSMLDGTGLRPFYEEADSSDYIENLRSFPLPTGHYAPGFIQPPKSPTSSRVPSR
FT                   SNSRKGREHAGTVSAAQLPRYNETPGKCILDLEYFKLYEDGHHVHTLKVMTSVNSDANG
FT                   NSHNHASKNDGHLDLPKGDDGSVVRQKSKFSLSGFFKPHSKEDIANADEKLKYAVSLLP
FT                   RNKICSKVETDRDTFAPVFTKTRSHVQSGSDDSSDDDEELDDPSIPKIVNKNAAVGSQE
FT                   LKLINNLSEKIRMGLSTAAKNKHNQSSKHRTPSGAGVQDENQPAFADLYGKCVAVVGHG
FT                   AYGVVKVCARTRDEKDDLPATKTYMDSKKIYFAVKELKPRPSDPIEKFSTRITSEFIIG
FT                   HSLSHYYDKNGEQSAPNILSIIDLLEYNDTFIEVMEFCPAGDLYSLLTARKNKIGKPLH
FT                   PLEADCFMKQLLKGIQFMHDHGVAHCDLKPENILLHPNGLLKICDFGTSCVFQTAWERH
FT                   VHFQTGLQGSEPYVAPEEYNPKKEYDPRLVDCWSIGIVYCTMIMGHYLWRNAARGKDSL
FT                   YDSFYEEMASKKEFYVFEELRHINQEINRLRRIALYQIFQPNPEKRISIDKLLQTGWMR
FT                   HTKCCVPYKNIPR"
     atgccagaac acgaggagcg ccatagccat ggcgtgaaca gatcgctatc tcttggtagt        60
     tcgatgagga gcttgtttaa gtctcagagg tctcgaggcc ccagtgatcg aggtgcaaat       120
     gggacccccg ggcctgcgca aaaagttgat atacgagtgg acacagccag tgcaagccgt       180
     gagcatacac cggtggtaca taaaacccca caatctgcca atccagagtt acaacaacca       240
     cgccatcatc tgggcttgcc aaacatcttg aagttaaact tgacgcctac taattcgaat       300
     ccacaatcca aatcagggtc tcctgtcagc cagaatacat cacaggaatc tctgattaca       360
     gatactgaca ttgaagttga ggactataga ccatccaagg acagtcgtcg tactgtgagg       420
     aacgccagtc ccatgtcaag taatggtaac ttgcctataa acgcaaacac tgtcattggc       480
     cctgacacaa gcagtaataa catagattcg atgctggatg gtactggctt gagaccattt       540
     tacgaagagg cagacagttc cgattatatt gagaacttac gaagctttcc gctaccgact       600
     ggccactatg cccctggatt tattcaacct ccgaaatctc ccacaagttc aagagtacca       660
     agtaggtcta atagcagaaa gggaagagag catgctggaa cagttagtgc tgctcagcta       720
     cctagatata atgaaacccc tggaaaatgc attttagatt tagagtattt caaactttat       780
     gaagatggtc accatgtcca caccctgaaa gtgatgactt cagtaaactc agatgcgaat       840
     ggtaatagcc ataaccatgc ttcgaaaaat gacggtcatt tagatctacc aaaaggtgat       900
     gacggctcag tggttagaca gaagtcaaaa ttctcattat ctgggttctt caaaccacat       960
     tcaaaggagg atattgctaa cgctgacgaa aaattgaaat atgctgtatc gttattacca      1020
     aggaataaaa tctgttcaaa agttgaaaca gatagagata cgttcgctcc agtctttacg      1080
     aagaccagaa gccacgttca aagtggaagc gatgacagtt ctgatgatga tgaagaactt      1140
     gatgacccat cgattccaaa aattgttaac aagaatgctg ctgtagggtc tcaggagtta      1200
     aaactaatca ataacttatc tgaaaagatt agaatggggt tatctacagc agccaagaac      1260
     aaacacaatc aatccagtaa acatagaaca ccgtctggag ccggagtcca ggacgaaaac      1320
     caacctgctt ttgctgatct atacggaaaa tgtgttgcag tcgtaggcca tggggcatac      1380
     ggtgttgtaa aagtatgtgc tagaactagg gatgagaagg atgatctgcc ggccaccaaa      1440
     acttatatgg acagtaaaaa aatatacttt gctgtaaagg agctgaaacc acggccatca      1500
     gacccaattg agaaattcag tactagaatt acctctgaat tcattattgg gcactctttg      1560
     agtcattact atgataaaaa tggtgaacaa tctgcaccta atattttgag tatcatagat      1620
     ttgttagaat acaatgatac ttttattgaa gtcatggaat tttgtccagc tggtgactta      1680
     tatagcctat tgacagcaag gaagaataaa atcggaaaac cattacaccc attagaagct      1740
     gattgtttta tgaaacagtt attaaaaggc atacaattta tgcatgatca tggtgttgca      1800
     cattgtgatc taaaaccaga aaacattctt cttcatccga acggtttatt gaaaatctgt      1860
     gattttggta ctagttgtgt gttccaaact gcatgggaga gacatgtaca tttccaaacg      1920
     ggccttcaag gctctgaacc ttatgttgca cctgaggaat acaaccccaa aaaagaatac      1980
     gacccaaggc tagttgattg ttggagtatc ggtatcgtgt attgtacaat gataatgggc      2040
     cattatttat ggagaaatgc tgccagagga aaggattctt tatatgactc tttttatgaa      2100
     gaaatggcct ccaaaaagga gttctatgta tttgaagagc ttcgccatat caaccaagaa      2160
     attaatagat tgcgcagaat agcactttac caaattttcc aaccaaaccc agaaaaacgt      2220
     atatcaattg acaaactact ccaaacaggt tggatgagac ataccaaatg ctgtgtcccc      2280
     tataaaaaca taccaagata a                                                2301
//

If you have problems or comments...

PBIL Back to PBIL home page