(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE365

CAGLA1_12.PE365      Location/Qualifiers
FT   CDS_pept        complement(836791..838179)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440077"
FT                   /locus_tag="CAGL0M08404g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG62687.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B7145"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ83"
FT                   /transl_table=1
FT                   /translation="MQILGENFKEVEIMDSEYDRRKLEEESAGPPGDEPMGQENHEQLE
FT                   NHIDKATESQMSKELVVEDDQYDQGSHNIDYEARNKEEHNNGTNRTDGGHTQGTEQSNE
FT                   QQTESNHEQQQQQRLQQTEQHQQHQMETVKKPLIYGANTSGKYTLSDFQILRTLGTGSF
FT                   GRVHLIRSNHNGRFYALKALKKHTVVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDS
FT                   QHVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKEIIYRDLKPENI
FT                   LLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIYEM
FT                   LAGYTPFYDANTMKTYEHILNSELKFPSFFHPDVQDLLSKLITRDLSKRLGNLQNGSED
FT                   VKNHPWFSEVVWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEEEINYGVQGEDPYADL
FT                   FREF"
     atgcaaatac tgggagaaaa ttttaaagaa gtcgagatta tggatagcga atacgacaga        60
     aggaaactcg aagaagagag tgcaggacct cctggtgacg aacctatggg tcaagaaaac       120
     catgagcagt tagaaaacca cattgataaa gctacagagt cccaaatgag taaagaactt       180
     gtggtggaag acgaccagta cgaccagggg agccacaata tcgactatga ggcaagaaac       240
     aaagaggaac ataacaatgg tacgaaccgg accgatggtg gacatacaca aggtactgaa       300
     caatcaaacg aacaacaaac agaatcaaat cacgaacaac agcaacaaca acgactacag       360
     caaacagagc agcaccaaca acaccaaatg gaaacggtga agaaaccgct catatatggg       420
     gctaacactt caggaaagta caccctatca gacttccaaa tattacggac tttaggaaca       480
     ggttcctttg gtagagttca tttaattcgg tcaaatcata atggtagatt ttacgctttg       540
     aaagcgctaa agaaacacac agttgtaaaa ttaaaacaag tagagcatac caacgacgaa       600
     agaaggatgt tatcgatagt gtcccatccc ttcatcattc gtatgtgggg tactttccag       660
     gactcacaac atgttttcat ggttatggac tacatcgagg gtggtgagtt attctcccta       720
     cttaggaaat cgcaaagatt tcccaaccct gtagcgaaat tttatgcagc cgaagtatgc       780
     ttggcattgg aatatttaca cagtaaagag ataatataca gagatttgaa gccagagaac       840
     attctacttg acaaaaatgg tcatataaag attaccgatt tcggatttgc taaatatgtt       900
     ccggatgtta catacacact atgtggtaca ccagattata ttgctcctga agtagtaagc       960
     actaagcctt ataacaaatc tgttgattgg tggagtttcg gtattttgat atacgaaatg      1020
     ttggctgggt atacaccatt ttatgatgca aatacaatga aaacttacga acacatttta      1080
     aactcggaac ttaagttccc ttctttcttc catccagatg tgcaagattt actgtctaag      1140
     ttaatcacca gagacttgag taaacgtctt ggtaacttac aaaacggcag tgaggatgtt      1200
     aagaaccatc cgtggtttag cgaagttgtc tgggagaaac tgctggcgag atacatagag      1260
     actccatatg aacctcctat ccaacaggga caaggtgata cttcccagtt tgacaggtac      1320
     ccagaagaag aaataaacta cggcgtacaa ggagaggatc cctacgctga tctattcaga      1380
     gagttttaa                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page