(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE369

CAGLA1_12.PE369      Location/Qualifiers
FT   CDS_pept        complement(849926..850558)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248193" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349522"
FT                   /locus_tag="CAGL0M08514g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62691.1"
FT                   /db_xref="HOGENOM:HBG058981"
FT                   /db_xref="HOGENOM:HBG626440"
FT                   /db_xref="UniParc:UPI00003B7149"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ79"
FT                   /transl_table=1
FT                   /translation="MQFNKISLLAMASAASAATTSPTTTETKPTTTKFFTPGDNFSTFA
FT                   PNATFSGAAVNFTSTFGIAVQSIDSKSVVSKSLVSTSTTSTLAPSSSTSSAASSTTSSP
FT                   NITIVNKSCKADGTLVMELENGILRDGKGRIGSIVSNRQFQFDGPPPQAGAIYAAGWSV
FT                   TPEGNLALGDSDVFYQCSSGNFYNLYDEYIAEQCHPIHLEVLSLVDC"
     atgcaattca acaagatttc actattggct atggcctctg ccgcttccgc tgccaccact        60
     tccccaacca ccactgaaac taagccaacc actaccaagt tcttcacccc aggtgacaac       120
     ttctctactt tcgctccaaa cgccactttc tctggtgccg ccgtcaactt cacatctact       180
     ttcggtatcg ccgtccaatc catcgactct aagtccgtcg tctcaaagtc cctagtgtca       240
     acttccacga catctacttt ggccccatcc tcttctactt cttctgccgc ttcttccacc       300
     acttcttctc caaacatcac catcgtcaac aagtcctgta aggctgacgg tactttggtc       360
     atggagctag agaacggtat cctaagagac ggtaagggta gaatcggttc cattgtctcc       420
     aacagacaat tccaattcga tggtccacca ccacaagctg gtgccatcta cgccgccggc       480
     tggtccgtca ctccagaggg taacttggcc ctaggtgact ccgatgtctt ctaccaatgt       540
     tcttccggta acttctacaa cttgtacgac gaatacatcg ctgaacaatg tcacccaatc       600
     cacttggaag tcttgtcctt ggttgactgt taa                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page