(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE373

CAGLA1_12.PE373      Location/Qualifiers
FT   CDS_pept        complement(855443..856036)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440081"
FT                   /locus_tag="CAGL0M08580g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62694.1"
FT                   /db_xref="HOGENOM:HBG124108"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="UniParc:UPI00003B714C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ76"
FT                   /transl_table=1
FT                   /translation="MSIDGYSYLQKYLVFADIKQLNTEVEQNVHYEKLVKAFPTVDKLI
FT                   IRAILLAARGDLAPAFNALLSLTGEDIQLGLPMRRYEFLPDKTLMEQALRAKQEDMLEQ
FT                   LSQLQEPSSKAKSAGSETKEKSVPTGDGVSTEAMTGEAQSEPQMMENNAEDPKDITDKG
FT                   LISDTKSEEANISVVEPQVENGKSVNPFELLQDE"
     atgagtattg acggctattc atatttacag aagtacttgg tatttgcgga catcaagcag        60
     ctcaatacag aagttgagca gaatgtgcac tatgagaagt tggtgaaggc gtttccaacc       120
     gtggacaaac ttattatacg ggccatcctc ttggctgcac gaggtgactt ggcaccagcg       180
     ttcaatgcgt tgttgagtct cacgggcgaa gacatccaat tggggttacc gatgcgtcgg       240
     tatgagtttc taccggacaa gacacttatg gagcaagcgt tgcgggccaa gcaagaggat       300
     atgttggaac aactgtctca gttgcaagag ccatcatcga aggcgaaatc agcaggatcc       360
     gaaacaaaag aaaagtctgt tccaacgggc gatggagtga gcactgaggc gatgacaggg       420
     gaggcacagt cagagccaca gatgatggag aacaatgcgg aggaccccaa agatataaca       480
     gataagggcc tcattagcga tactaagtcc gaagaagcga atatcagtgt tgtagaacca       540
     caagtggaga atggcaagag tgtcaatccc tttgagctgt tgcaagatga atga             594
//

If you have problems or comments...

PBIL Back to PBIL home page