(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE375

CAGLA1_12.PE375      Location/Qualifiers
FT   CDS_pept        complement(859796..860809)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000059940" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501698"
FT                   /locus_tag="CAGL0M08624g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="tryptophan-tRNA ligase activity"
FT                   /biological_process="tryptophanyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG62696.1"
FT                   /db_xref="GO:0004830"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006436"
FT                   /db_xref="HOGENOM:HBG003090"
FT                   /db_xref="HOGENOM:HBG293263"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI00003B714E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ74"
FT                   /transl_table=1
FT                   /translation="MVQPTGKFHLGNYLGATRVWKDLCDIKQPGQRLIFGVADLHAITI
FT                   PKPDAAQFKQLRREAIASILAVGVDPARASIMYQSAIPAHSQLYWLLSTVAPMGYLNRM
FT                   TQWKSKSNLREDKDATAKELGEVKLGLFGYPVLQAADILLYKATHVPVGDDQVQHLELT
FT                   RTLAENFNKLYKKQVFPLPRTLLAPTKKILSLTHDTKKMSKSDPNQDGVIYVNDPPETI
FT                   IRKIKKARTDSITDKFYYDPVHRPGLSNLINIVSGITKQPVHAVEQELQKFDNYRDLKA
FT                   HVSEVIIEELRVPREKFHQYMEDPQFLDDTVQQGTQRASEIAASTMKETMQTMGFI"
     atggttcagc ccactggcaa gttccatctg gggaattacc tgggtgctac gcgggtgtgg        60
     aaggacttgt gtgacatcaa gcaaccgggc cagcggctga tctttggcgt tgctgatctg       120
     cacgcgatca ccatcccaaa gccggacgcc gcgcaattca agcagttacg ccgtgaggcg       180
     attgctagta tccttgcagt tggtgtcgat cctgccaggg cgtcgattat gtaccaatcg       240
     gcgatacctg cacactcgca gctttactgg ctgctgagca ctgtggcccc catgggctat       300
     ttgaaccgta tgacccaatg gaagtccaag tccaacctgc gtgaggacaa ggacgccaca       360
     gcgaaagagc tcggtgaagt gaagctgggc ctgttcgggt acccggtgct ccaggcagcg       420
     gacatcctgc tttacaaagc cacgcatgtt ccagtcgggg acgaccaggt ccagcacttg       480
     gagctcacgc gtacattggc tgagaacttt aacaagctat ataagaaaca ggtgttcccc       540
     ttgccacgca cattgctggc acccaccaag aagatcctgt ctctgacgca cgacaccaag       600
     aagatgtcaa agagcgaccc caaccaggac ggcgtcatat acgtgaacga cccgccagag       660
     accatcattc gcaagatcaa gaaggctcgc acggactcga tcaccgataa gttctactac       720
     gacccggtgc acagaccagg cctctcaaac cttatcaaca ttgtcagcgg tattacgaag       780
     caacccgtcc acgccgtgga gcaagagttg cagaaattcg ataactacag ggacttgaag       840
     gcacacgtct ctgaagtaat catcgaagaa ctccgtgttc ctagagagaa gttccaccag       900
     tacatggagg acccacagtt tctcgacgac accgtccaac aaggtacaca gagggcatca       960
     gagatagctg ccagcacaat gaaagagaca atgcagacta tgggattcat atag            1014
//

If you have problems or comments...

PBIL Back to PBIL home page