(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE376

CAGLA1_12.PE376      Location/Qualifiers
FT   CDS_pept        861488..862501
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208901" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440082"
FT                   /gene_name="CIA1"
FT                   /locus_tag="CAGL0M08646g"
FT                   /product="Probable cytosolic iron-sulfur protein assembly
FT                   protein 1"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62697.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG520580"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B714F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ73"
FT                   /transl_table=1
FT                   /translation="MPLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNG
FT                   KENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELL
FT                   AIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHV
FT                   VWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGS
FT                   DDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYK
FT                   EKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGKEMLITAGDDGRVNLWNYQD"
     atgcctttac aattagccaa atcgcttaag ttacacaacg acaaagtgtg gtccattgat        60
     tttgagcctg taagaggact cttggccact ggatccaccg atagagctat aaaagtttta       120
     caattgaaga atggcaagga gaacttactg gatgtgctgg atgacactgt tcataagaaa       180
     gcagtaagat cagttgcatg gcgtccacat tctgatctgt tggctgctgg ctccttcgac       240
     tctactatat ctatatggac gcagagtgac ctcgaccttg aagagggtgc caagttagag       300
     atggagctgt tggccatcat cgagggccac gaaaatgaag tcaaggggat ctcttggtcc       360
     caagatggtt gtctgttggc tacatgttct agagacaaga gtgtatggat atgggagacc       420
     gatgaagcag gcgaggagta cgaatgtatc agtgttttgc aagagcactc tcaggatgtt       480
     aaacacgtag tatggcacac aaaacataac ttactagcat ctagttcata tgatgataca       540
     gtgagaattt ggaaggatta cgacgacgat tgggaatgtg cagcggtgct taccggtcat       600
     gaaggtacta tatggtgttc tgacttctca aaggaggaag accccatcag attatgtagt       660
     ggtagcgacg actcaactgt gcgtgtatgg aaatatattg gtgacgatga agatgaccaa       720
     caggaatggg tttgcgagtc gactttgccg aatgcacaca gatcacagat atacggtgtc       780
     gcctggtcac catccggacg tattgcctct gttggtgcag atggtgtcct tgccgtatac       840
     aaagaaaagc agaatgactc tgaagtaagc gaatgggaaa tatctgccac gtacaaagct       900
     gcacatactg tttatgagat aaatacagtt aaatgggtaa atatagacgg caaagaaatg       960
     ctaataaccg caggtgatga cgggagagtg aacctgtgga attaccaaga ctaa            1014
//

If you have problems or comments...

PBIL Back to PBIL home page