(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE378

CAGLA1_12.PE378      Location/Qualifiers
FT   CDS_pept        complement(865182..866168)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180194" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045131"
FT                   /locus_tag="CAGL0M08690g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="zinc ion binding"
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="CAG62699.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059227"
FT                   /db_xref="HOGENOM:HBG717253"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00003B7151"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ71"
FT                   /transl_table=1
FT                   /translation="MVEEDRRWKLPFAGAPSIVQAHQKDEQIETMLSVKVSELLRGVRG
FT                   QLFINNYQKEISVVVKLIYLGLTTALSRRTLGEEYVDLIYVNKRGSQLVRGIKRVLFVL
FT                   SYTSIPYLVTKLSKKVNNRSTNNEESDDGNESTYTDILSTMIDLHLMVFYITGTYYDVF
FT                   KRFWGMRYALGHTLSQEEENYRDKSSKSYKILGYIILLQHISKVKPIINKVLSILPQTK
FT                   ETLNAGSNGVGLKEGFAPAATPGLLTDVPENFNIDHIKLSNGKELAFIPTESRNCILCL
FT                   MEMTDPSCLPCGHVFCWDCITDWTKENPECPLCRQRSYPQQVLALRA"
     atggttgaag aagatagacg atggaagttg ccgtttgctg gtgcaccttc aatagtgcag        60
     gcgcaccaga aggatgaaca gattgagaca atgttatcgg taaaagtcag cgagttacta       120
     cggggggtaa gaggtcagtt gttcattaat aactatcaga aggagatctc agtggttgtc       180
     aagctgatat atttgggact gacgactgca ctatccagaa gaacattggg tgaggaatat       240
     gtcgatctga tatatgtgaa taaacggggt tctcagttgg tgagaggaat taaacgggtc       300
     ctatttgtgc ttagttatac ttctattcct tatttggtca ctaagctctc aaagaaggtc       360
     aataatagga gtacaaataa tgaagagagt gatgatggca acgagagtac ttacaccgat       420
     attttgagta ctatgattga cctgcatttg atggtgttct atataactgg tacttattac       480
     gatgtattta agcgtttttg gggtatgaga tatgcattgg ggcatacttt atcacaagaa       540
     gaagaaaact atcgtgataa gagtagtaag agttacaaga ttctaggtta cattattctt       600
     ttacaacata tttctaaagt taaacctatt attaacaagg tcctgagtat cttaccgcag       660
     acaaaggaaa cattaaatgc tgggtccaat ggtgttggac taaaagaagg atttgcacct       720
     gcagcaacac cagggttatt gacagatgta cctgaaaatt ttaacattga tcacatcaaa       780
     ttaagtaatg gtaaagagct ggcatttatt cccacagaat caagaaattg tattctttgc       840
     ttgatggaaa tgactgatcc aagctgtcta ccttgtgggc atgtattttg ttgggactgt       900
     atcacagact ggactaagga aaatccagaa tgccccttat gtcggcaacg tagctatcct       960
     caacaggtgt tggcattaag agcatga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page