(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE380

CAGLA1_12.PE380      Location/Qualifiers
FT   CDS_pept        complement(869007..869768)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000065942" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196346"
FT                   /locus_tag="CAGL0M08734g"
FT                   /product="FAS1 domain-containing protein CAGL0M08734g "
FT                   /cellular_component="vacuole"
FT                   /protein_id="CAG62701.1"
FT                   /db_xref="GO:0005773"
FT                   /db_xref="HOGENOM:HBG059223"
FT                   /db_xref="HOGENOM:HBG203230"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="UniParc:UPI00003B7153"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ69"
FT                   /transl_table=1
FT                   /translation="MVALKYVLVPVALVAAKNIVEMITFRDENGKLHRRLAPEEYRGGV
FT                   LDGEESRLLQKRDLEMHPPVDLGVYFSNRPIHRTIDVPDIYLDSQISVLTELDIFASYS
FT                   RNDEKSYDMFRDPESDLIVIAPTNAAITALAKKPWQFPMDIDTMEQAGSSERDIDNAIH
FT                   NNIVNFVRSHVVAYQKDTKTSKDGTVLLQSKQYSMQHSNGKGGDVLLKREGEKYCVASV
FT                   VDEVFHDVQNIYSTKNGVILVIDATLSRPGA"
     atggttgcgc tcaagtacgt tttagtgccc gtagcactgg tggctgcgaa gaatattgtt        60
     gagatgatta cgtttcggga tgagaacggt aagttgcata ggaggttggc tccagaggag       120
     tatcgtggcg gtgtgttaga cggtgaggag agtcgattgt tgcagaaacg tgatttagag       180
     atgcatcctc cagttgacct gggggtatat ttcagtaata ggccgattca ccgcaccatc       240
     gatgtgccgg acatatattt ggactctcag atatcagtgc tgacggagct agatattttt       300
     gcttcgtatt ctcgtaacga tgagaaaagt tacgacatgt tcagagatcc cgagagtgat       360
     ctgatagtga tagcacctac caatgctgct atcactgctc tggctaagaa accatggcag       420
     ttccccatgg acatagatac catggagcaa gctggctctt ctgagaggga tatcgataat       480
     gccattcaca acaatatcgt aaactttgtg agatcccatg tcgtggcata tcagaaagat       540
     accaagactt cgaaagatgg cactgttctc ttacagagta aacagtacag catgcaacat       600
     tcaaatggta aaggcggtga cgtcttgcta aagagagagg gggagaaata ctgtgttgcg       660
     tcagttgttg acgaagtatt tcacgatgtt cagaacattt attccaccaa aaatggtgtc       720
     atcctggtga ttgatgccac gttgtccagg cctggtgctt ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page