(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE381

CAGLA1_12.PE381      Location/Qualifiers
FT   CDS_pept        870824..872533
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000114462" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440083"
FT                   /locus_tag="CAGL0M08756g"
FT                   /product="Similar to uniprot|P52911 Saccharomyces
FT                   cerevisiae YDR261c exo-beta-1 3-glucanase "
FT                   /function="actin filament binding"
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /function="protein binding, bridging"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAG62702.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030674"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="GO:0051015"
FT                   /db_xref="HOGENOM:HBG176634"
FT                   /db_xref="HOGENOM:HBG735468"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniParc:UPI00003B7154"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ68"
FT                   /transl_table=1
FT                   /translation="MLHLFVVIFLALGVLGYDNSGLTTDELQSLQKRFQDYYNDGEVQV
FT                   KGITIGGWLVTEPYITPSLYETAFTHVNKTLNGTNSTTFQNSTFGNYSIVDEYTLCKEL
FT                   GYQNALTLLKDHYETFITEDDFAQIKENGFNLVRLPIGYWAWKKNSNDTSRYNYVGNIS
FT                   YDDPYVSEGLQLQYLLKAIDWASKYELNVWIDLHGAPGSQNGFDNSGQRILYDDLGWLH
FT                   ADKTKPLTLAIWKDMFEKFVRTNNYNGYNTSSVVGLEIMNEPLGPKIGMRNIAQSYYEA
FT                   FDMFKTAEAENNNPQNDNLTFVIHDAFQSIGYWNLHLNPDYRNVSNQYYNLTNVTYNSQ
FT                   SVLVDHHHYEVFTDFQLKNNQYNRIMDIINYGDSISKELDFHPAVVGEWSGAITDCARW
FT                   VNGIGIGARYDGSYYKTTAFQSDSPPNGTCISQNDISTWSESYKTRVRQFIEAQLATYS
FT                   AKTTGWIFWNWKTENAAEWDYLKLKENNLFPQPFDNFTYFNKDGQINSSFSTSLSIEAF
FT                   GSPTSSRVSSTKHKNFAISTKMRTSITGSSNNNTWMYFLSAALGMLAVCCVM"
     atgctgcatt tatttgtggt aatattctta gcactcggcg tgttgggata tgataactca        60
     ggtttgacaa cagatgaatt gcaaagtctg cagaagagat tccaggatta ttacaacgat       120
     ggcgaagtgc aagtgaaagg tatcacgatc ggaggctggc tggttactga gccttacatt       180
     acaccttcat tatatgaaac agcatttacc catgtgaata aaactctaaa tggtaccaac       240
     agcaccactt ttcaaaatag cacgtttggt aattactcaa ttgtcgatga atatacgctg       300
     tgtaaggagt tgggctatca gaatgcactt acattgctga aagatcacta cgagactttt       360
     atcacagagg atgattttgc acagattaag gaaaatggtt tcaacctcgt gcggttacct       420
     ataggttatt gggcttggaa gaaaaactcc aacgatacaa gcaggtacaa ttatgttggt       480
     aacattagct atgatgatcc atacgtaagc gaaggattac aactgcaata cctactgaaa       540
     gcgattgatt gggccagcaa atacgagtta aatgtttgga ttgaccttca tggtgctcct       600
     ggttcacaaa atggttttga taactcagga cagagaatat tgtatgacga cctgggatgg       660
     ctgcacgcag acaagacgaa accattaacc cttgcaatct ggaaagacat gtttgagaaa       720
     tttgtaagga caaataatta caatggatat aatacttcct ctgtggttgg tctagaaata       780
     atgaacgagc ccctgggccc aaagatcggt atgcgtaaca ttgcccaatc ttactatgag       840
     gcctttgaca tgttcaagac ggcagaagct gagaataata atccacaaaa tgacaatttg       900
     acatttgtaa tccatgacgc tttccaatct attggttact ggaacttaca cttgaatcca       960
     gattatagaa atgtctcaaa tcaatactac aatttgacta atgttacata taattcacag      1020
     tcggtgttgg tcgaccacca tcattatgaa gtttttactg acttccaatt aaaaaacaat      1080
     caatataata gaataatgga tatcatcaac tatggtgact ctatttccaa agaactagac      1140
     ttccatccgg ctgtagttgg cgaatggtct ggtgctatca ccgattgtgc aagatgggtc      1200
     aatggtattg gtattggggc aagatacgat ggctcctact acaagactac tgcttttcaa      1260
     tccgatagtc caccaaacgg tacatgtata tcgcaaaatg atatcagcac ctggtccgaa      1320
     agctacaaga ctcgagtcag acaatttatc gaggctcaat tggcgacata ctccgcaaaa      1380
     accacaggtt ggatattttg gaattggaaa acagagaatg ccgctgagtg ggattatcta      1440
     aaattgaagg aaaataacct atttcctcag ccattcgata actttacata cttcaataag      1500
     gatggccaaa tcaatagctc attctctacc tcgttgtcaa tagaagcctt tggaagccct      1560
     acaagctcta gagtgtcttc aacaaaacac aaaaactttg ccatctctac caagatgaga      1620
     acttcaataa ctggatcatc caacaacaac acatggatgt acttccttag tgctgcccta      1680
     ggtatgctcg ctgtttgctg tgtgatgtag                                       1710
//

If you have problems or comments...

PBIL Back to PBIL home page