(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE383

CAGLA1_12.PE383      Location/Qualifiers
FT   CDS_pept        878328..879119
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501701"
FT                   /locus_tag="CAGL0M08800g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG62704.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG124111"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI00003B7156"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ66"
FT                   /transl_table=1
FT                   /translation="MGQVNMRPSLASQPAHYQLPSIAPNIHPHQYTTSQPPHQQHYHVV
FT                   HTPISRISSENGQQQHMMPPSMNPTAYQGPEQVIIDHGIPTFQYAHQPQHVLRSSIMTG
FT                   ANMSPGQPQPQTIVMGPQPIQHAIDGHLASQTIATPMGTTLLTSSAQLQGQKTKKNTKR
FT                   AMQNRKAQKAFRQRKEQYIKLLENEAKLIDDVMKKNQDLTSENEQLRDCLNRLIEKLKD
FT                   NGIEVDIPSDFLDKINASISASRRLQEQHEEISKSIAGEKS"
     atgggacaag ttaacatgcg accgtctctg gcttcacaac ctgcacacta tcaattacca        60
     agcatagcac caaatataca cccgcatcag tacaccacta gtcaaccacc acatcagcaa       120
     cattaccatg ttgtgcacac cccaatctct cggatctctt cggaaaatgg tcaacagcag       180
     cacatgatgc ctccatcgat gaaccccaca gcataccaag gtcccgaaca ggttatcatc       240
     gaccatggca tacccacttt ccaatatgcg caccagccac aacatgtact acgcagtagt       300
     ataatgacgg gagccaatat gagtcccggg caaccccagc ctcaaacgat tgtgatgggc       360
     cctcagccta tccagcatgc aattgacgga catttagcaa gccaaacaat cgcgacgcct       420
     atgggaacta cacttctgac gtcgtcggcc caattacaag gccagaaaac caagaagaac       480
     acgaagaggg caatgcaaaa taggaaagcg caaaaggcat ttcgacagcg gaaagagcaa       540
     tatatcaagc tactagagaa tgaagcaaaa cttatagatg atgttatgaa gaagaaccag       600
     gacctcactt ccgaaaacga gcaactgaga gactgcctga atcgcttgat agaaaaactg       660
     aaggacaacg gcatcgaagt cgacatcccc tccgatttcc tagataagat taacgcttca       720
     atcagtgcca gcaggcgatt acaagagcaa cacgaagaga tttcaaaatc aattgctggc       780
     gagaagtcct ag                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page