(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE384

CAGLA1_12.PE384      Location/Qualifiers
FT   CDS_pept        880145..882508
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000218211" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440084"
FT                   /locus_tag="CAGL0M08822g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAG62705.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG229122"
FT                   /db_xref="HOGENOM:HBG413133"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="UniParc:UPI00003B7157"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ65"
FT                   /transl_table=1
FT                   /translation="MLSRVCRSSLRNSVARVSRYAGPRALALSMVVSGRQVSGSWQTCA
FT                   YGVRYIHSSRPRYVQMRMNPNQGEPEKPPLEQFGTNLTKLARDGKLDPVIGRDEEISRA
FT                   IQILSRRTKNNPVLIGRAGVGKTALIDGLAQRIVAGEVPESLKDKELVALDLGALIAGA
FT                   KYRGEFEERLKKVLEDIDKADGKVIVFIDEVHMLLGLGKTDGSMDASNILKPKLARGLR
FT                   CISATTIDEFKIIEKDPALTRRFQPILLNEPSVQDTISILRGLKERYEVHHGVRITDTA
FT                   LVSAAVLSNRYINDRFLPDKAIDLVDEACAVLRLQHESKPDEIQRLDRAIMKIQIELES
FT                   LKKETDPVSIERKEDLEKELERKNEELQRLTKIWEEEKAEIESIKNSKADLEKARIELD
FT                   RCQREGDYAKASELRYAKIPALEEKVKLSETKDSNKENLLHDAVTSDDISKVIAKMTGI
FT                   PMETVLKGDKDRLLYMENSLRERVVGQDEAIEAVSDAVRLQRAGLTSEKRPIASFMFLG
FT                   PTGTGKTELTKALAEFLFDDESNVIRFDMSEFQEKHTVSKLIGAPPGYVLSESGGQLTE
FT                   AVRRKPYAVVLFDEFEKAHPDVCKILLQVLDEGKLTDSLGHHVDFRNTIIVMTSNIGQD
FT                   ILLSDTKLDDEGKIDPSTRNEVIEAMKRSYPPEFINRIDDILVFNRLSKKVLRSIVDIR
FT                   AKEIQERLNDKRMTIEISDTAKEWLTEHGYDQLYGARPLNRLIHRRILNPMATYLLKGQ
FT                   IRNGETVQVDVENKELVVKSNHAEGEIVDEEPEK"
     atgttaagca gggtatgtag gtcgtcgttg aggaacagtg tagctagggt ctcgcggtac        60
     gctggtccga gggctctggc tctgtccatg gttgtaagcg ggaggcaggt tagtggtagt       120
     tggcaaacgt gtgcttatgg tgtgcggtac atacatagtt cgaggcctcg gtatgtgcag       180
     atgcgtatga atcccaatca aggagagcct gagaagccgc ctttggagca gtttggtact       240
     aatctgacga agttggctag ggatggtaag ctggatcccg tgataggtcg tgacgaggag       300
     atctcgaggg ctatccagat cttatcgaga aggaccaaga acaacccggt tctgatcggg       360
     agagctggtg tcggtaagac tgcacttatc gatggcttgg cgcaacggat tgtcgctggt       420
     gaagtaccgg agtcgttgaa ggataaagaa ctagtggcct tagatctggg tgctctgatc       480
     gctggtgcga agtacagagg tgaattcgaa gaaaggctga agaaagtcct ggaggacata       540
     gacaaagcag acgggaaagt gatagtgttt attgatgagg tccacatgct gcttggcctc       600
     gggaaaactg acggtagcat ggatgcttcc aatatattga agccaaagtt ggcaagagga       660
     ctaaggtgca tatctgccac tacaatcgat gagttcaaga taatcgagaa ggatcctgct       720
     ctgactagga gattccaacc tatcttgcta aatgaacctt ctgtgcaaga tacaatctct       780
     atcttaagag gtctaaagga aagatacgaa gttcaccacg gtgtcaggat cacggatact       840
     gctctggtgt ccgctgctgt actatcaaac aggtacatca acgatagatt cttaccagat       900
     aaggctatcg acctggtgga tgaggcatgt gctgtgttga ggttacaaca tgagtcaaag       960
     cccgatgaga ttcaaagatt ggatagggcc attatgaaaa ttcaaattga actagaatca      1020
     ttaaagaaag aaactgaccc agtgtctatt gaaaggaaag aagatctaga aaaagagcta      1080
     gaaaggaaaa atgaggaact tcaacgacta actaagatct gggaggaaga aaaagctgaa      1140
     atagagtcta ttaagaactc caaagccgac ttggagaaag ctagaatcga attggataga      1200
     tgccaaagag aaggtgacta tgcaaaggcg tccgagctta gatatgccaa gatcccagct      1260
     ttagaagaga aagtgaaact cagcgaaact aaggactcaa ataaggaaaa cttactgcat      1320
     gatgctgtca cttcagatga tatttcaaaa gtcattgcca agatgacagg tattccaatg      1380
     gaaacagtat taaaaggaga caaagataga cttttatata tggaaaactc cttgagagaa      1440
     agagttgtag gtcaagacga agctatcgaa gctgtttcag atgcagtgag actacaaaga      1500
     gctggcctaa cgagtgaaaa gagaccaatt gccagtttca tgtttctggg cccaactggt      1560
     acaggtaaga ccgaactaac caaggcgctt gctgagttcc tgttcgatga cgagtctaat      1620
     gtaattagat ttgatatgtc cgagtttcag gaaaaacaca ctgtttcaaa gttaataggt      1680
     gcccctccag gatatgtatt aagtgaatca ggtggtcaat taacggaggc tgttaggcgg      1740
     aaaccttatg ctgtcgtttt gttcgatgaa tttgaaaagg ctcatccaga tgtttgtaag      1800
     attttgttgc aagtccttga cgagggtaag ttgacagatt cattgggaca ccacgtcgat      1860
     ttccgtaata ccataattgt catgacttct aatattggtc aagatatttt actatcagac      1920
     acgaaattag atgacgaagg gaagatcgat ccatctacaa gaaacgaagt tatcgaagcg      1980
     atgaaaagat cttatcctcc agagttcatt aatcgtattg atgacatcct agtgttcaat      2040
     agattatcca agaaggtcct aagatcgatt gtcgacatca gagccaaaga aattcaagaa      2100
     agattgaacg ataagcgtat gacgattgaa atatcggata ctgctaaaga atggctgaca      2160
     gaacacggtt atgaccaact atatggcgct agacctttga atagattaat tcatagaaga      2220
     atattgaatc ctatggcaac ttatctatta aagggccaaa tcaggaatgg tgaaaccgtc      2280
     caagtagatg ttgaaaataa ggaacttgtt gttaaaagta atcacgccga aggagaaatc      2340
     gtggatgaag aacctgagaa ataa                                             2364
//

If you have problems or comments...

PBIL Back to PBIL home page