(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE387

CAGLA1_12.PE387      Location/Qualifiers
FT   CDS_pept        complement(886536..887063)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142065" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440085"
FT                   /locus_tag="CAGL0M08888g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62708.1"
FT                   /db_xref="HOGENOM:HBG124112"
FT                   /db_xref="HOGENOM:HBG203317"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="UniParc:UPI00003B715A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ62"
FT                   /transl_table=1
FT                   /translation="MNRDQKIQFRDKQIRHKYALLHAMPTIDVPELSGMYLKNFYNSVK
FT                   RYQLNLPDHIVQPDKKFCGECGYIQIPDHSVDINIISGERPEISSIAKFKCKKCGHHYD
FT                   ETVLCRKQKVADSANISKDIGQVKKKTNNAKMRAKMRKQNSLTSLLSKKDKEKKDVTKS
FT                   ASMLSLDSFMKR"
     atgaaccgag accagaagat acaattcaga gacaagcaaa tacggcataa atatgcacta        60
     ttacacgcta tgcctactat agatgtgcca gagctttcag gaatgtattt gaagaatttc       120
     tataattcag taaaaaggta ccaactcaat cttccggacc atatagtaca acctgataag       180
     aagttctgcg gtgaatgtgg gtatatacaa attccagatc atagtgtcga tattaacatt       240
     ataagtggtg agcgtcctga gatttcaagc atagcaaaat tcaaatgtaa gaaatgtgga       300
     catcattatg atgaaacggt actttgtaga aaacaaaaag ttgcagatag tgctaatata       360
     tcgaaagata ttggacaagt gaaaaaaaaa actaataatg ccaagatgcg tgctaaaatg       420
     agaaaacaga attcacttac ctcactattg agcaaaaagg ataaggaaaa aaaagatgta       480
     accaaatccg catcgatgtt atcgctagac tccttcatga aacgttaa                    528
//

If you have problems or comments...

PBIL Back to PBIL home page