(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE392

CAGLA1_12.PE392      Location/Qualifiers
FT   CDS_pept        complement(896312..897358)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045132"
FT                   /locus_tag="CAGL0M09020g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG62713.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B715F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ57"
FT                   /transl_table=1
FT                   /translation="MSSSKKKSSNPVVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQ
FT                   AAPAAAAVASMAGGAGGAATATVGGGDATAAIKPPGFIRTGRNIYAQEGFLALYKGLGA
FT                   VVIGIIPKMAIRFSSYEFYRTLLADKQTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVK
FT                   IRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGISALYRGVSLTAARQATNQGANFTV
FT                   YSKLREFLQEYHGTETLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTSFKGES
FT                   GWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLENLGVFSKP
FT                   TPKPKKLN"
     atgtcctctt ctaaaaagaa atcttctaac ccagttgtga acctggtggc tggtggtact        60
     gccggtctgt ttgaagctct gtgttgtcat ccactagata ctataaaggt gcggatgcaa       120
     atttacaaga gacaggcggc acccgctgct gctgcagttg caagcatggc tggcggtgct       180
     ggaggtgctg caactgctac tgtcggtggt ggtgatgcca ctgccgctat taagccacct       240
     ggattcatta gaaccggtag aaacatatat gcgcaagaag ggtttttggc cctatataaa       300
     ggtctagggg ccgttgtcat cggtattatc ccaaagatgg ccatcagatt ttcttcctat       360
     gagttttaca gaactctgct ggctgacaaa caaacaggtg ttgtttccac aagtaacact       420
     ttcatcgcag gtgtaggtgc tggtgtcact gaagctgtct tggttgttaa ccctatggaa       480
     gttgttaaga ttagactgca ggctcagcac ttaaacccta accatgactt ggccaaacca       540
     aaatatacaa atgccgttca agcaggttac actatcatta aggaggaagg tatctctgct       600
     ctatacagag gtgtttcttt aactgctgcc agacaagcca caaaccaagg tgctaacttt       660
     actgtttact caaagttgag agagttccta caggaatacc acggtaccga aacattacca       720
     tcttgggaaa catcctgtat cggtttgatc tctggtgcta ttggtccatt ttcaaatgct       780
     ccactggaca ctatcaagac tagactacaa aaggataagt ctactagctt caaaggtgaa       840
     tctggatgga agagaattgc tcacattggt actcaattgt taaaggaaga aggtttcaga       900
     gctctttaca aaggtattac cccaagagtg atgagagttg ctccaggtca agccgttaca       960
     ttcacagtat acgagtttgt cagaagacac ctggagaacc tgggcgtctt cagtaaacct      1020
     acaccaaaac caaagaagtt gaactga                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page