(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE393

CAGLA1_12.PE393      Location/Qualifiers
FT   CDS_pept        901459..902817
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440088"
FT                   /gene_name="ime1"
FT                   /locus_tag="CAGL0M09042g"
FT                   /product="Putative meiosis-inducing protein IME1 "
FT                   /protein_id="CAG62714.1"
FT                   /db_xref="EMBL:CAD59555.1"
FT                   /db_xref="HOGENOM:HBG124114"
FT                   /db_xref="UniParc:UPI000006CBE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q8J0L9"
FT                   /transl_table=1
FT                   /translation="MNNSCPGVTEKDKFIIRRNLILFDEDEEFKRLTDIRSSYIPLSRA
FT                   MHSSSPNFKEAKVASRGCKTYRQSEDINGDNSHEISTLNNYFFDGGNPHPTTNNTIKLA
FT                   TNWDDTDKYINFSVCEELTPVTDYKNCIIDQDPLLLADSPLNMSVSTDMIDNDLGSAYS
FT                   ELDFHSNYDFEDYSISYDNNYRGDYFNDSTEDVSPNFSKSTNYTSKLPIEIIHTQPHKL
FT                   INPKILSTTFDIELSSFINEETYLLSSKYSEASSFSSIFSYDIDNIQNIASITNSSGEL
FT                   MKEANFCNEQNERDSVVTIKLETKNNKKTTKYSIKKETHFPIPDQHKFNDNIEYYYYFD
FT                   PDEGNPIILPEYPPLRTYEVSTGFKKKKRINKEPKPVIKTKKSQANSYVHRTSKNRIRK
FT                   SKDSKSNKEFFTSLLSKLDRYCVNAYGRRSRNQEYYDKVRFQEILYKFSKTYF"
     atgaataata gttgtccagg tgtcacggaa aaggacaagt ttattattag gaggaatctg        60
     atattatttg atgaggacga agaatttaaa agattaacag atattcgcag ctcatacatt       120
     ccactttcaa gggctatgca tagtagtagc ccaaatttta aagaggctaa ggtagcttca       180
     cggggttgca aaacttatag acagtctgaa gacattaatg gagataactc acacgaaatt       240
     agtacactca acaattactt ttttgatggc ggcaaccctc atccgacaac taacaacacc       300
     ataaaactag ctacaaattg ggatgacacg gacaaatata ttaattttag tgtttgtgag       360
     gaattaactc ccgttacgga ttacaaaaat tgtatcatag atcaggaccc tttattattg       420
     gcagattcgc ctctaaatat gtcagtttca acagatatga ttgacaacga cctaggaagc       480
     gcttattcag agcttgactt ccacagtaac tatgattttg aagactacag catttcctat       540
     gataataact acagaggtga ctacttcaac gactccactg aagatgtttc tccaaatttc       600
     tcaaaatcta caaattatac ttctaaactt ccaattgaaa tcattcatac ccagccacat       660
     aaattgataa atccaaagat tttatcaact acttttgata tagagttgtc atccttcata       720
     aatgaagaaa cctaccttct atcatcaaaa tattcagaag cctcttcttt ctcctcaatc       780
     ttttcatatg atatagacaa catccaaaat attgcttcca taacaaactc atctggtgaa       840
     ctaatgaaag aagcaaattt ttgcaatgaa caaaatgaaa gagactctgt tgttacaata       900
     aaattggaaa ccaagaacaa taagaaaacc accaaatatt caataaagaa agaaacccac       960
     tttcctattc ccgatcaaca taaatttaat gataacatag agtattacta ttattttgat      1020
     cctgatgaag gaaacccaat aattctacct gagtatcccc cattaagaac ctatgaagta      1080
     tcaacagggt tcaaaaagaa aaaacgaata aataaggaac ccaaaccagt gataaaaaca      1140
     aaaaaatcac aagcaaattc ttatgtccac cgtacatcta agaatagaat acgtaagtct      1200
     aaggattcga agagtaataa ggaatttttt acttcattac tctcaaaatt agatagatat      1260
     tgcgttaatg cctacggtag acgctcaaga aaccaagaat attatgataa agttaggttc      1320
     caggaaattt tgtataagtt cagcaagacc tatttttaa                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page