(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE396

CAGLA1_12.PE396      Location/Qualifiers
FT   CDS_pept        910473..913802
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113136" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440091"
FT                   /locus_tag="CAGL0M09108g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG62717.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG060044"
FT                   /db_xref="HOGENOM:HBG203961"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B7162"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ53"
FT                   /transl_table=1
FT                   /translation="MEKKFTNIPEVIDPGITIPIFEEDVDAMSLEQPQKLGSYRARAGK
FT                   FSNTLSNLLPSISAKLHHSKKQGKGAGADPNASTPDSSESAIGNLSAKSSQMFMMNTDQ
FT                   GMPSMTAAVAADMGPPRPAHVEGFSARGAAQDNTTPPRDADKLVHFPESTEYLISRPRT
FT                   SNDSFGNNLPRQISRTRNNTMSSQITSISSIVPKPLPNTVWNNNDTVNQQYQQQQQQQQ
FT                   QQQQQMVPQINTYNAMDMGQQPNYGDTMNQQMGGNNLTVNNAWNSNRPRSHSNASSIYT
FT                   DAPQYDTVGRSRAASSYAHGNSNIPLVADEVDPRSLNWVTTDLLVPPINQISNLLPTNT
FT                   ISISNVFPLQQQQPHLNNAINLTSASLATLCSKYGEVISARTLRGINMALVEFDSVDSA
FT                   IRALDALQGKEVSMIGAPSKVSFAKILPMHYQQSNHTQQQNAQTTQAESVSQPLLQEQL
FT                   NNGAVTFHQQGNISIPVFNQNQYSNGQNTNNNASSHPGTSSSSDKEQCPFPLPPPPLSG
FT                   KKSELEQVVLQFNSDHDESQVASLINNSLKTKPTSDVNNFGPLPGSVSNKQFDAPKLRE
FT                   LRKAIDSNSLSDIEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTG
FT                   KYLASMGVHKNGTWACQKIITKATTPRQIKLVTDGIKDYCTALFNDQFGNYVIQCVLKF
FT                   GYPWNSFIFESILSNFWTIVQNRYGARAVRACLEAHDIVTMEQTLVLSAMIVIYAEYLT
FT                   TNSNGTLLVTWFLDTCVLSNRHSILAPRLVNHIVDLCRHRLASLTILKILNYRGDDAAR
FT                   KTILNTVFGNCETDEPQQILYQILCDVNYGPTFVYKVLSMPLLEDDIRIHIIAQVRKIL
FT                   MESNTAQHHRRLMEEVGLMTTGNNNNQTSNNKHRKNSSHTYVQDNNGHMRGVSVSSVRS
FT                   GGSRQTGLTPNIPQTFQMPSLPNTSMSTVVSGNMSLNQLPTQMQQQQQSGVLPQTVQQQ
FT                   QQQPMVGSNQNNAMSYMNYPGVFPMGYPNNNSSYGINDDLVSKLDMLTLGNGTHLSLPQ
FT                   LSVTNHENNTNYSNNNNNNNNNNNNNNNSNGNNNTNGGNPMNLMNSSLNNTQEFGGSSL
FT                   WN"
     atggagaaga agtttactaa tataccggaa gtgattgatc ccgggatcac aatcccgatt        60
     tttgaagagg atgtggatgc gatgtcgctg gagcagccgc agaaactggg gtcgtatagg       120
     gcgcgtgctg gtaagttcag caacacgctg agtaacctgt tgccgtctat atctgcgaag       180
     ctgcaccact cgaagaagca agggaaaggt gctggtgcgg acccgaacgc gtccactccg       240
     gacagctctg agtccgcgat cgggaacttg tctgcgaagt cctcgcagat gttcatgatg       300
     aatacagacc agggtatgcc ctccatgacc gcggcggtgg cagcagatat gggccctccc       360
     agaccagcac acgtggaggg attctccgcc agaggcgccg cacaggacaa cactactccg       420
     cctagagacg ccgacaaact cgtccacttc ccggagtcca cggagtactt gatctccaga       480
     ccccggacgt caaacgactc cttcggcaat aacttgccac gccaaatttc gcgcacgaga       540
     aacaatacta tgtcctcaca gattacatca atctcatcca tagtccctaa acctctgcca       600
     aacacagtct ggaacaacaa cgatacagta aaccagcagt accaacaaca acagcagcag       660
     cagcagcagc agcaacagca aatggtccca cagataaaca cttataatgc tatggatatg       720
     ggccagcaac ctaactacgg cgataccatg aaccaacaga tgggtggcaa caacttaact       780
     gtgaacaacg cctggaactc aaatagacca agatcacact caaacgcatc gagcatatac       840
     acagacgcac cacagtacga cacagtcggc aggtctagag ccgcatcgag ctacgcccac       900
     ggcaactcaa acattccatt agtagcagac gaagtcgacc caaggtctct gaactgggtc       960
     accactgact tgctagtacc acccatcaac caaatctcta acttgctacc aacaaacacc      1020
     atctcgatat cgaacgtgtt tccattacaa caacagcaac cccatttgaa caacgccatc      1080
     aacctgacca gtgcatcatt ggccactctg tgctctaaat acggtgaggt catctcagca      1140
     agaactctaa gaggcatcaa tatggctttg gttgaattcg acagcgtcga cagtgctatt      1200
     cgcgcactag atgcattaca aggaaaagaa gtctccatga tcggcgctcc tagtaaagtt      1260
     tcctttgcga agatcttgcc aatgcactac cagcagtcta atcatacaca acagcaaaac      1320
     gctcaaacaa ctcaggcaga gtcagtgtcc cagcctttac tgcaagaaca actcaacaat      1380
     ggcgctgtca ctttccacca acaaggtaat atatccatcc cagtgttcaa ccaaaatcag      1440
     tacagtaatg ggcaaaatac aaacaacaat gcctcctctc acccaggaac ctcatcgtcc      1500
     tctgacaagg agcaatgccc atttcctttg cctcctcctc ctttgtcagg aaagaaatct      1560
     gagttggaac aagtggtttt gcaatttaat tcagatcacg atgaaagcca agtagcctcg      1620
     ttaataaaca atagcttgaa gacaaaacct acatcagatg tcaacaattt cggaccgttg      1680
     cctggatcag tctcaaacaa acagtttgat gcaccaaaat taagggaact tagaaaggca      1740
     attgattcga atagtttgtc agatattgag attgagcaat tagcaattgc aatgctggat      1800
     gaattaccag aactaagttc agattattta ggtaacacaa ttgtccaaaa gctgtttgaa      1860
     cactctagtg atatcattaa ggacataatg ctaaggaaaa ctggtaagta tttagcttca      1920
     atgggtgtcc acaaaaacgg tacttgggct tgccaaaaga tcataacgaa ggctaccaca      1980
     ccaaggcaaa tcaaattggt aactgatggt atcaaggatt actgtacagc tcttttcaac      2040
     gaccagttcg gtaactatgt tattcaatgt gtgctgaaat tcggctaccc ttggaactca      2100
     ttcatctttg aaagtatact ttcaaatttc tggactatcg tgcaaaacag atacggtgct      2160
     cgtgcagtta gagcatgtct ggaagctcat gatatcgtca ccatggaaca aactttggtg      2220
     ttgagtgcta tgatcgtcat atatgcagaa tatttaacta ccaatagcaa tggaacattg      2280
     ctagttacat ggttcctaga cacatgcgtt ttatcaaata gacattccat tttagctcca      2340
     aggttagtta accatatcgt tgatctctgc cgtcatagac tagcttccct aactatcctc      2400
     aaaattttga actacagagg tgatgacgct gctagaaaga caatcttgaa tactgttttt      2460
     ggtaattgcg aaacagatga accccaacaa attctttacc aaattttatg cgacgttaat      2520
     tacggcccaa catttgtcta caaagtacta tccatgcctt tattggagga tgatataaga      2580
     atacacataa tagcgcaagt tagaaagatt cttatggagt ctaatacggc gcagcatcac      2640
     cgtcgtttga tggaagaggt tggtttgatg accaccggta ataataataa ccagaccagc      2700
     aacaataagc acaggaagaa ctcttctcat acatatgttc aagataataa tggacatatg      2760
     agaggtgtct cggtttctag tgtacgcagt ggaggatcta gacaaacagg tttaactcca      2820
     aatataccac aaacgttcca aatgccaagc ttgccaaata cttctatgag caccgttgtg      2880
     tctggaaata tgtctctaaa tcaactacca acgcaaatgc agcaacaaca gcaatctggt      2940
     gtactacctc aaaccgttca acagcagcag cagcaaccta tggtgggctc caaccaaaac      3000
     aatgctatga gttacatgaa ttaccctgga gtcttcccta tgggctatcc gaataacaat      3060
     agcagctatg gaataaacga tgatcttgtg tcaaaactag atatgcttac tttgggaaat      3120
     ggtactcact tatcattgcc tcaattgagt gtcacaaacc atgaaaataa cactaactac      3180
     agtaacaata acaataacaa taacaataac aataacaata acaataatag taatggtaat      3240
     aataatacca atggcggtaa tcccatgaac ttgatgaatt cttccttgaa taacacccaa      3300
     gaattcggtg gatcatctct atggaattaa                                       3330
//

If you have problems or comments...

PBIL Back to PBIL home page