(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE397

CAGLA1_12.PE397      Location/Qualifiers
FT   CDS_pept        914811..918188
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112822" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045133"
FT                   /locus_tag="CAGL0M09130g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62718.1"
FT                   /db_xref="HOGENOM:HBG059230"
FT                   /db_xref="HOGENOM:HBG202254"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="UniParc:UPI00003B7163"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ52"
FT                   /transl_table=1
FT                   /translation="MDITNQNHSIDTPMPDTRPDIEFGFGYNAGTTRGGPSLASMQIQQ
FT                   GTNTHHQINNDISFNIGNNDTNSNDTNENIHVDSLRNNGNIQRFTAGDRLPNTIGNQSV
FT                   AMARSIPGSIESRNGFPQDGEALMDMSNVESIDYNAPAKIFADMDINRLFYDPNLSSLQ
FT                   AEDIIKLHNFKEVVHRKIENFIEVIQKRRERILKEIELGNQRLEGVDLETSVSAMTYLN
FT                   KLQRIRISALKSETMELQNLRIQIVSIVDEYKKAMAEYSKLNQEGRNAVNPTPYFQRWI
FT                   KSLNPEDISGLNKELIELQMYSKQLSDIPELASIEYQVSTPQTSQFPLRSLPSEILHLV
FT                   LDKITQKADIVNLLRVCKLWALIIVKILYYRPHINRKHQLDLFMRTMKLTKDETVFDYR
FT                   SMIKRLNFSFVGDHLHDEELYNFVGCRNLERLTLVFCKHITSDPVAAVLKGCKYLQSVD
FT                   ITGIKEIYDNVFDTLAESCKRVQGFYVPQAKLVSYNALTNFVSNAPMLKRIKVTANANV
FT                   NDEFLDLLAEKCPLLVEVDITLSANVHDSSLTKLFMKLTQLREFRITHNANVTDKFFLD
FT                   LSKNVNQLPSLRLLDLSGCENITDKTIDRVVQLSPKLRNIFLGKCSRITDLSLFHLSTL
FT                   GKNLQTVHFGHCFNITDRGVRALIKSCPRIQYVDFACCTNLTNHTLYELSYLSRLKRIG
FT                   LVKCSQMTDDGLLNMIALRGRNDSLERVHFSYCSNLTIYPIYELLMACPRLSHLSLTAV
FT                   PSFLRPDITAFCRPAPSDFSDNQRQIFCVFSGKGVHKLRHYLMSLTTPTDGPQIDVGDT
FT                   LEQYVISKHLLRPGEYLNDGIRRITSELNQDSAAILAATGLNQMNGMNSDFPFQNIDFE
FT                   RLDEVFNWINMSMDGHSLNSDELNDLISEVDRDFCDDPFDEDYNSRDSIVAPGANTGLN
FT                   SELCHIVKKFHRLDDQICDFEVNVSSLARVQFQFTGFLLHEMAQAYMNMVEINRQIWHI
FT                   QKTTLEAGVESDIKALLVWRILFIDKFTALLHKYQISTVVLRLYLKDSITLLTRQRELF
FT                   LAHQRTPWNPTIVEEAPDSNYWQLVGDRIQLLPEQMRVMPFGLRNPAIANNAQQNAAEA
FT                   QNDDRSETPEDDVAIEDF"
     atggatataa ctaaccagaa ccacagtata gatacaccaa tgcctgatac gaggccagat        60
     attgagtttg gatttggtta taatgctgga accactcgtg gcgggccatc cttggcttcc       120
     atgcagatac aacaaggtac caacacacac catcagataa ataatgatat atccttcaat       180
     attgggaata atgacactaa cagtaatgac actaatgaaa acattcacgt tgatagctta       240
     agaaataatg gtaatattca aagatttaca gcaggggata gactgccgaa cactattggt       300
     aatcagagtg tcgcgatggc tcgaagcatt ccaggaagca tcgagagtcg caatggcttt       360
     ccacaagatg gcgaagctct catggatatg agtaacgtgg aaagcataga ctataacgcg       420
     ccagcaaaga tatttgcaga tatggatatt aatagattat tctacgatcc aaatttgtcg       480
     agcttacagg cagaagatat cataaagctc cataatttca aggaggttgt tcatcgcaaa       540
     attgaaaact ttatcgaagt gatacagaaa cggagagaga gaatattaaa agagatagaa       600
     ttaggaaacc aaagattgga gggagttgat cttgagactt ctgttagtgc tatgacatat       660
     ctaaataagc ttcagagaat aaggataagc gcgctaaaat ctgaaactat ggagctccaa       720
     aacttaagaa tccaaattgt aagtatcgtc gacgaatata agaaagcaat ggcagagtat       780
     agtaaactga atcaagaggg tagaaatgcc gtgaacccta ctccatattt ccaaagatgg       840
     ataaaatcat taaacccaga agatatatca ggtcttaaca aagaattgat tgaattacag       900
     atgtactcca aacaactgtc agatatacca gagctggctt caatagagta tcaggttagt       960
     actccacaaa cctcacaatt tcctctccgt tctttaccat ctgagatact gcatcttgta      1020
     cttgataaaa taacacagaa agctgatatt gtgaatttgt taagagtctg taagctatgg      1080
     gctcttatca tagtgaaaat attgtactac cgcccacata ttaacagaaa gcaccagtta      1140
     gatttattta tgcgaacaat gaagttaact aaggatgaga cagtgtttga ttaccgatca      1200
     atgattaaaa gactgaattt ttcctttgtt ggagatcatc tgcatgatga agaactttac      1260
     aacttcgttg gttgtcgaaa tttggaacga ttgacattag tattttgtaa gcatattaca      1320
     agtgacccgg tggcagcggt tttaaaggga tgcaaatacc tacagagtgt tgatattact      1380
     ggtatcaaag aaatttatga taatgtgttt gatacattgg ctgagagttg caaaagggta      1440
     cagggatttt atgtacccca ggctaagctt gtatcatata atgcattaac aaattttgtt      1500
     tccaatgcac caatgttaaa aagaatcaaa gttactgcca atgctaacgt gaatgacgaa      1560
     tttttagatc ttctggctga aaaatgtcca cttttggttg aagtggatat aacactcagt      1620
     gcaaatgtgc atgatagtag tttgacaaag ctatttatga agttgacgca gcttcgtgaa      1680
     tttagaatta ctcataatgc aaatgtgact gacaaattct ttctagatct ttcaaagaat      1740
     gttaaccaac ttccatcatt aaggttactc gatttatctg gttgtgaaaa tatcacggat      1800
     aagactattg atagggtagt tcaattatct ccaaaattaa gaaacatatt cttaggaaaa      1860
     tgtagtagaa tcacagattt atccttattt catttatcta cgcttggaaa gaatctacaa      1920
     actgtgcatt ttgggcactg cttcaatata actgatcggg gtgttagggc tctaataaaa      1980
     tcatgtccac gtattcagta tgttgatttt gcctgttgta ctaatctgac aaatcataca      2040
     ttatatgagc tatcttatct aagcagactc aaaagaattg gcctagtaaa atgttcacag      2100
     atgacagatg acggtctttt aaatatgatt gccttaagag gaaggaatga tagtttggaa      2160
     agggtacatt tttcatattg ttcaaactta acaatatacc ccatttatga gcttctaatg      2220
     gcctgtccaa ggttatcaca tttatcattg actgctgtac cttcatttct tcgtccagat      2280
     ataacagctt tttgtaggcc agccccatct gacttcagtg ataaccagag acaaatcttc      2340
     tgtgtgtttt cagggaaagg tgttcataaa ctccgtcatt acttaatgag cctgacaaca      2400
     ccaacagatg gccctcaaat tgatgttggt gatacattgg agcaatatgt tatttcaaag      2460
     catttgctcc gtcctggtga gtatttaaac gatggtataa gaaggattac cagcgagcta      2520
     aatcaggatt ccgctgcgat tttggcagca actgggttaa atcagatgaa tggtatgaat      2580
     agtgactttc cctttcagaa tattgacttt gaaagactgg atgaggtgtt taactggatt      2640
     aatatgtcaa tggatggtca ttcactaaac tctgatgaac taaatgactt gatatctgaa      2700
     gttgatagag atttttgcga tgatcccttt gatgaagact acaatagcag ggattctatt      2760
     gtggcacctg gggcaaatac aggcttgaat agcgaacttt gtcatattgt taaaaagttt      2820
     cacaggttag atgatcaaat ttgtgacttc gaggttaacg tatcaagtct ggctagggta      2880
     cagtttcaat tcacaggatt tctactacat gaaatggcac aagcgtatat gaatatggtt      2940
     gaaataaaca gacagatttg gcacatccag aagactacat tggaagctgg tgttgaaagt      3000
     gatattaagg ctttattggt atggaggata ttgtttatag ataagttcac agctttgctt      3060
     cacaaatacc agatatcgac ggtggtgtta agactctatt tgaaagacag tataacctta      3120
     ttgactagac aaagggagtt atttttagct catcaaagga caccttggaa tcctacaatt      3180
     gttgaagaag cacctgattc aaactattgg caattagttg gagaccgcat acaacttctt      3240
     cctgagcaaa tgagggtcat gcccttcggt ttgagaaatc cagccattgc aaacaatgca      3300
     cagcagaacg cagctgaagc ccaaaatgat gaccgctcgg agacacctga agatgatgta      3360
     gcaatagaag acttttaa                                                    3378
//

If you have problems or comments...

PBIL Back to PBIL home page