(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE399

CAGLA1_12.PE399      Location/Qualifiers
FT   CDS_pept        complement(922042..922308)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210889" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349526"
FT                   /locus_tag="CAGL0M09207g"
FT                   /product="Guanine nucleotide-binding protein subunit gamma "
FT                   /function="signal transducer activity"
FT                   /biological_process="G-protein coupled receptor protein
FT                   signaling pathway"
FT                   /cellular_component="heterotrimeric G-protein complex "
FT                   /protein_id="CAG62722.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0005834"
FT                   /db_xref="GO:0007186"
FT                   /db_xref="HOGENOM:HBG058451"
FT                   /db_xref="HOGENOM:HBG397684"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="UniParc:UPI00003B7165"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ50"
FT                   /transl_table=1
FT                   /translation="MEVSQSQLDLKIKYLKLKRINELNDKLRDELQRERITASNACLQL
FT                   IAYTTSTRDYALPTLWGYPPADTNHFRDFQTQHADDATCCTIM"
     atggaagtgt cacaatcgca attggacttg aagatcaagt atttgaagct caagcggatc        60
     aacgagctca atgacaagct cagggacgag ttgcagcggg agcggatcac ggcatccaat       120
     gcttgcttgc aattgattgc ttacaccact tccactaggg actacgcctt gcccacacta       180
     tggggctatc cacctgccga tactaaccac ttcagggact tccaaacgca gcatgcagac       240
     gatgctacgt gttgtaccat catgtaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page