(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE4

CAGLA1_12.PE4        Location/Qualifiers
FT   CDS_pept        complement(26473..27207)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214596" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044074"
FT                   /gene_name="MGM101"
FT                   /locus_tag="CAGL0M00198g"
FT                   /product="Mitochondrial genome maintenance protein MGM101 "
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="mitochondrial genome maintenance "
FT                   /cellular_component="mitochondrial chromosome"
FT                   /protein_id="CAG62329.1"
FT                   /db_xref="GO:0000002"
FT                   /db_xref="GO:0000262"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG192030"
FT                   /db_xref="HOGENOM:HBG448424"
FT                   /db_xref="InterPro:IPR009446"
FT                   /db_xref="UniParc:UPI00003B6FE4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK91"
FT                   /transl_table=1
FT                   /translation="MQRLLKFSGHGSRALFLARRWNSNIASGTAGTFQTTAKPLRSVKP
FT                   TEAALALNGKFLESTNGNENGITSMGSIDWYTSWHGLGSKPFDATVQKALALPLEPTDI
FT                   EIKPDGLIYLPEIKYRRILNRAFGAGGWGLVPRSQTIVTSKLVTREYGLVCHGQLVSVS
FT                   RGEQDYFSETGIPTATEGCKSNALMRCCKDLGIGSELWDPVFIKRFKTEHCVEKFVTHI
FT                   ATSKKKKIWIRKDRSVEYPYKA"
     atgcaaaggc ttttgaaatt tagtgggcat ggcagcaggg cgttgttcct ggcccggagg        60
     tggaactcta acatagcgag tgggacggct ggcacgtttc aaaccactgc taagccactg       120
     agatctgtca agccaacaga agcagctttg gcacttaacg ggaagtttct ggagtcaaca       180
     aatggtaacg aaaatggtat cacttctatg ggctcgatcg attggtacac ttcatggcat       240
     ggtcttggca gtaaaccgtt tgatgccact gtacaaaaag cactcgcgtt acctttggaa       300
     ccaacagaca tagaaatcaa acccgacggg ctgatatatc tcccagagat caagtacaga       360
     cgcatattga atagggcctt cggagctggt ggttggggtc ttgtgcccag gtcccaaacc       420
     atcgtaacat caaaactagt gacacgagaa tacggattag tatgccacgg ccagttggta       480
     agcgtttcac gtggtgaaca ggattatttc tcggagacag gaatacccac agccacagaa       540
     gggtgcaaga gtaatgctct aatgaggtgc tgcaaggatc taggtatcgg ttcagagcta       600
     tgggatcctg tatttatcaa gaggttcaag actgagcact gtgtggagaa attcgtgaca       660
     catattgcaa catcaaaaaa aaagaaaata tggataagaa aggatagatc agttgagtat       720
     ccttacaaag cataa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page