(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE40

CAGLA1_12.PE40       Location/Qualifiers
FT   CDS_pept        107989..109311
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436696"
FT                   /gene_name="ATG23"
FT                   /locus_tag="CAGL0M00968g"
FT                   /product="Autophagy-related protein 23 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62364.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG124118"
FT                   /db_xref="UniParc:UPI00003B7007"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK56"
FT                   /transl_table=1
FT                   /translation="MLNDILVEVAEKTQLLESLIIPHERALTESDYSDQLENIRAEISA
FT                   TLNSLSNLNDLLISHDGPLRTEISSLMASKSKLKKINMKELTLLNEQETLETLRNDSSN
FT                   LESSRPGFTTQQQQSITIASSYRHELQKYLDLVDVEKTSLNTNKLADNSKISKEDVENS
FT                   DFNFNLKRYEKQQSILHSALTVNEIEIKKLETLLKEFRKDNNFIRDELKLINSNLKSHE
FT                   DLISDELKQIDESRYAIMQSIGYSGRNEQQSSILDSIVKLSIKKPDIRTLIQERIEEYS
FT                   NLLNFIDMKLNGLDQMLQEYKSRKSEWAEKSILWSQCLALISELEVTVRDQLSSAHTVG
FT                   SEISPDQIKAQIKKFLTKLNKLLDESDLEDVVYSLVRNEVNSLNVALDEMNQMPQIKND
FT                   ISDRESIHNPSFKLISKSPPKTGFSSENVSYKLNNTNIKKD"
     atgctaaacg acattttagt tgaggttgca gaaaaaaccc agttactgga atccctgatc        60
     atacctcatg agagagcact cactgagtcg gattactctg atcagttaga aaacataagg       120
     gctgaaatct cagcgactct caatagttta agcaatctga atgatttact catatctcat       180
     gatgggccgt tacgaacaga aatctcatcg ttaatggcaa gcaaatccaa gttgaagaag       240
     atcaacatga aagaacttac acttctcaac gaacaagaga cgttggagac tcttcgtaac       300
     gattcttcaa atttggagtc atcaaggcca ggattcacca cgcagcagca gcaatctatt       360
     acaatagctt catcttaccg ccatgaactt cagaaatacc tagacttggt cgatgtggag       420
     aaaacctcgc tcaacaccaa caaactggcc gataattcga aaatatctaa agaggatgta       480
     gaaaactccg atttcaattt caatctgaaa cgttacgaaa agcagcagtc gatattacat       540
     agcgctctga cagtcaatga gatagagata aagaaattag aaacactgct gaaagaattt       600
     agaaaggata ataacttcat cagagatgaa ttaaagctga taaatagtaa tcttaaatca       660
     cacgaggatt taattagtga tgaactaaag caaatcgatg aatcccgtta tgctattatg       720
     caatcaattg gctatagtgg caggaatgaa caacagtcgt ccatattaga tagcattgtg       780
     aaattatcaa taaaaaagcc tgatattcgc acactaatcc aggaaaggat cgaagagtat       840
     tcaaacctat tgaatttcat tgatatgaag ttaaatggac tagatcaaat gctacaagaa       900
     tataaatcaa ggaaatctga atgggcagaa aaaagtatcc tttggagcca atgtcttgcg       960
     ctaatatcag aattggaggt tacagttagg gatcaattat cttcagcaca tactgtaggc      1020
     tcagaaatta gtcctgacca aattaaagca caaataaaaa aattcttaac caagcttaac      1080
     aaattattag acgaatccga tttagaggat gttgtatatt ccctggttag aaatgaagtt      1140
     aacagtttga atgtggccct tgatgaaatg aatcaaatgc ctcaaatcaa aaatgatatc      1200
     tctgatagag aaagcattca taatccctca ttcaaactaa tcagcaaatc accacccaaa      1260
     actggattta gcagcgagaa tgtaagttat aagctgaaca acacaaatat aaagaaagat      1320
     taa                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page