(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE401

CAGLA1_12.PE401      Location/Qualifiers
FT   CDS_pept        complement(923094..924443)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045134"
FT                   /gene_name="CSN12"
FT                   /locus_tag="CAGL0M09251g"
FT                   /product="COP9 signalosome complex subunit 12 "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="signalosome"
FT                   /protein_id="CAG62724.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008180"
FT                   /db_xref="HOGENOM:HBG124119"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="UniParc:UPI00003B7167"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ48"
FT                   /transl_table=1
FT                   /translation="MEYSRFVDCFERRSYTAEFLEFVGFKLSSEPLGATALILGGSQAK
FT                   QARYGDVNALYDAIVQIKLKESLTSLRELDPNAAVKKNKQRKVHQRVVDVFQALTNELR
FT                   ILNKILERSDDSVWLVYPVYTVCHDVSTFLRDTGKYMQLESRKQLWEECIRVIHRSFMI
FT                   CLNDKNPNMQENKRGGCILFANLEMMFYKMLRNRDMMKNLIKVLESTGMTDISRQRDNK
FT                   VLKRHRSQKIIFNYFIGEYYGCYLFQFNKAQEHLQVCVSEFPVKYTSSKWFKRIIHLYT
FT                   QFRMLATSNKLIHVELPRETNEKFANAYDSDLMNKCYKNGDTIVFDELIKEHAAQYLID
FT                   GTYSAMLLIKELVFLRLVKVCYKVNDKKSILPLDLIAAGYRIHFRNHDNEENRVTTTNP
FT                   RKLQKKNEDLLDELECRIANLIANGRIKGYLSHSQRCMVLSKTEPFPLAS"
     atggagtata gcagatttgt ggactgtttt gagcggagga gctacaccgc tgagtttctg        60
     gagtttgtgg ggtttaagtt atcgagcgag cctcttggag ccactgcgct gatactgggt       120
     gggtctcagg cgaagcaggc ccgctatggc gacgtgaatg cgctctacga tgccatagtg       180
     cagatcaagt tgaaggagag tctgacctcg ctgcgggagc tggatcccaa cgctgctgtg       240
     aagaagaaca agcagaggaa agtacaccag agggttgtcg atgtgtttca ggcactcacc       300
     aatgagctca gaatacttaa taagattctg gaaaggtccg atgactctgt ctggctggtg       360
     tacccggtgt acactgtgtg ccacgatgtc tctacgttcc tgagagatac tggcaagtac       420
     atgcaactag agtcccgcaa acagctctgg gaggagtgca tcagagtcat ccacaggagt       480
     tttatgatct gtctcaatga caagaacccc aatatgcagg aaaacaagcg tggtggctgt       540
     atcctgtttg ccaacttgga gatgatgttt tacaaaatgc tgaggaacag ggacatgatg       600
     aagaacttga tcaaggtcct ggagagtaca ggaatgaccg atattagtag acaaagagat       660
     aacaaggtgc tgaaaaggca tcgcagccag aagattattt tcaattattt cattggtgag       720
     tactatggtt gttacttgtt ccaattcaac aaggcccaag agcatttgca agtctgtgtc       780
     tctgagttcc cagtcaaata cacaagctcg aagtggttca agaggattat acacttgtac       840
     acccaattca gaatgctcgc tacttccaac aaattgatac atgtagaatt acccagagaa       900
     acaaacgaga agttcgctaa tgcctacgat agcgatctca tgaacaagtg ctacaagaac       960
     ggtgacacaa tagtgttcga tgagttgata aaggagcatg ctgctcaata tttgatagac      1020
     ggtacttatt cggcgatgtt attgataaaa gaactggtgt tcctgcggct ggtgaaggtt      1080
     tgctacaagg taaatgacaa aaagagcata ctgccactag acctgatagc tgcaggttac      1140
     agaatacact tcagaaacca cgacaacgag gagaaccgtg tcactaccac caaccctcgt      1200
     aaattgcaaa agaagaacga ggacttactc gatgagctcg agtgtaggat agctaacctc      1260
     attgccaatg gcagaatcaa aggttacttg tcacatagcc agaggtgcat ggttctaagt      1320
     aaaaccgaac ctttcccatt ggcatcgtaa                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page