(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE403

CAGLA1_12.PE403      Location/Qualifiers
FT   CDS_pept        925881..926156
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000817" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440093"
FT                   /gene_name="EAF6"
FT                   /locus_tag="CAGL0M09295g"
FT                   /product="Chromatin modification-related protein EAF6 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62726.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058457"
FT                   /db_xref="HOGENOM:HBG202249"
FT                   /db_xref="InterPro:IPR015418"
FT                   /db_xref="UniParc:UPI00003B7169"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ46"
FT                   /transl_table=1
FT                   /translation="MSDEYQSVKQELKALLADRKELEDKLDKLQQEIYDKESEYFDVDG
FT                   GSKSYHNILRGFDGMSRTQSNNSNMTNNDRIFSLSSASYVKQVQDQ"
     atgagtgatg agtatcagtc tgtgaagcag gagctgaagg ctcttcttgc tgaccggaag        60
     gagcttgagg acaagctgga caagttgcag caggagatat acgacaagga gagcgagtat       120
     tttgatgttg acggcggttc gaagagctac cacaatatcc ttcgtgggtt tgacggcatg       180
     agcaggactc agagcaacaa ctcgaacatg acgaacaacg acagaatctt ctctctgagc       240
     agtgcgagct atgtgaagca agtgcaagac cagtga                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page