(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE404

CAGLA1_12.PE404      Location/Qualifiers
FT   CDS_pept        926244..927407
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000066089" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440094"
FT                   /gene_name="AIM24"
FT                   /locus_tag="CAGL0M09317g"
FT                   /product="Altered inheritance of mitochondria protein 24,
FT                   mitochondrial"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG62727.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG253069"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="UniParc:UPI00003B716A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ45"
FT                   /transl_table=1
FT                   /translation="MLKSRFKVVGKEALMASLPLEPSVPMCIRKGCLVSVMAGGAHGSG
FT                   KTASLVIGHKWVNFWTNLARFRSWNSSLYHVLTTSGKENRALVAPNISRGSPWLSALKL
FT                   VVSILSKNSKGITITDPQRSIYPLELDGTQDWNVWGRDSLIAFEQNDSLDIKPASLSSS
FT                   LKRDALFSHSHKYQVVTGRGSVLLGGYGDIYSIDLKNSTDDIVINAQNILAVSGKGQTE
FT                   TMNAIENNPFIISHTAASNIPEFTSNVQELAAFEDPKQQQSQTIVQKTVKEAARASKAV
FT                   WHWISYVYKKTVIFSNNNGHNITSPAFVKIKGPRTIIIQTSHETTQPVSVSTVDILPRT
FT                   VENAIPEVVETPKAKSDSYINYATVQPDGNVTFRSVSNFNETIAERY"
     atgttgaagt cgcggtttaa agttgttggg aaggaggccc ttatggcatc gttgccattg        60
     gagccctctg tgccgatgtg tataaggaag ggatgcctgg tgtctgtgat ggcaggtggt       120
     gcgcatggga gcggtaagac tgctagtttg gttataggtc acaaatgggt caacttctgg       180
     actaatttag ccaggtttcg gtcctggaac agctctctgt accacgttct cacgacttct       240
     gggaaggaga atcgtgccct ggttgcccca aacatctcca gagggtcgcc ttggctgagt       300
     gcattgaagc tggtcgtaag tatattgtcg aagaactcga aagggattac tatcacagac       360
     cctcagcgca gtatttaccc attagagctc gatggtactc aagattggaa cgtatggggg       420
     cgtgactccc tgattgcatt tgaacagaac gatagtttag atatcaaacc tgcatctttg       480
     agcagctctc tgaagcgtga tgctctgttt tcccatagtc ataagtatca agtggttact       540
     gggcgcggta gtgttttatt aggtggatat ggcgatatat actcaattga tttgaagaat       600
     agcacggatg atatagtaat aaatgctcag aatatccttg cagtttctgg taaaggccag       660
     actgagacta tgaatgctat cgagaacaat ccattcatca tctcccatac agccgcatcg       720
     aacataccag agtttacttc aaatgttcaa gaactagctg cttttgaaga ccccaaacag       780
     cagcaatccc agaccatagt gcaaaagact gtaaaggaag ctgctcgtgc ttctaaagca       840
     gtttggcatt ggatatccta tgtatataaa aaaactgtca tattcagtaa caacaatggt       900
     cataatatca cttctccagc atttgtaaag atcaaggggc caagaactat cattatacag       960
     acatcacatg agactacaca acccgtaagt gtcagtactg ttgatatcct tcctagaaca      1020
     gtagagaacg ctattccaga agtcgttgaa acgccaaagg caaaatctga tagctatata      1080
     aattatgcaa cagtgcaacc tgatggtaat gtgacattta gaagtgtatc aaactttaat      1140
     gaaacaattg ctgaacggta ctag                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page