(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE406

CAGLA1_12.PE406      Location/Qualifiers
FT   CDS_pept        complement(928484..931918)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176156" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440096"
FT                   /locus_tag="CAGL0M09361g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62729.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG055849"
FT                   /db_xref="HOGENOM:HBG396709"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000861"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011072"
FT                   /db_xref="InterPro:IPR015745"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniParc:UPI00003B716C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ43"
FT                   /transl_table=1
FT                   /translation="MLSQVEQDIRRKIAVEENIIKGSSALKKKTDNVMVIQKCNTNIRE
FT                   ARQNIEYLEETLKKLQLSQSQQGQTDSQQQQANDDSTVTEIDRGQGYRQLSTIAPEEHV
FT                   FSRLDLVKYDCPSLAQKIQYMLQQLEFKLQVERQYQEANNKLTKLYQIDGDQRSSSAAE
FT                   GGALESKNRVQLLKKALKKYQAINVDLDQYYKHHNDESLKDMQPKLREKQLTGMLTIGI
FT                   TAIRDVDHIQSPLFARNPETFITVKIDDVVKSRTKPSRNDRWNEEFSIEVDKGNEIEIT
FT                   IYDRVNESVTPVAVMWLLLSDIAEEIRKKKVGKTNGQGWVRAASIKSQTVHNSQAVANR
FT                   TYASDSRTTSLNNSNSDLNQDMSLSPTQVTTNAWFVLEPAGQILLTLGFHKTSQHQRKN
FT                   LVGGLHRHGAIINRKEEVYEQHGHHFVQKSFYNIMCCAYCGDFLRYTGFQCQDCKFLCH
FT                   KKCYGNVVTKCISKASTETDPSEAKLNHHIPHRFEPVSNRGTKWCCHCGYILPWGKQKV
FT                   RKCTECGIMCHTQCAHLVPDFCGMSMEMANKILKTIEDTKRTQEKKKRKPPQTNASALT
FT                   STSTMIGSSVHDRLDSSPSKSMNASIPSIPSPRKHPYAANQYHEKAEEHQMQNQNRLNN
FT                   YIEDNEAYLKFTSGVGVPGASQDVKAQNMNDAYVDQYGHEYQQDNNDSQLKASEDELEL
FT                   WKQHRERMERELQQEQQMQMSYDNNAEGQIDLYTKQASGDVNMLPAVDETVSSHNNPFR
FT                   DMNHETFEQTQNYVANQLQGDVTDIRSSTEIITAAGNNVSPQKRSSGKHKKRGSKRPKV
FT                   SLDNFVLLKVLGKGNFGKVILSRSKNTNRLCAIKVLKKDNIIQNHDIESARAEKKVFLL
FT                   ATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRAKFYAAEVLLAL
FT                   KFFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDGMWYGNKTSTFCGTPEFMAPELL
FT                   REQDYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGDIVQIF
FT                   QGLLTKDPEKRLGAGPRDALEIMEEPFFRNINFDDLLNLRIKPPYIPEIKSAEDTSYFE
FT                   QEFTSAPPSLTPLPSVLSTTQQEEFRGFSYMPEDLEL"
     atgctgtcac aagtggagca agatatccgg cggaagatag ctgtcgagga gaatatcatt        60
     aaaggatctt ctgcgcttaa gaagaagact gataatgtta tggttatcca gaaatgtaac       120
     acgaacatac gtgaagcccg tcagaatatt gagtatcttg aagagaccct caagaagttg       180
     caattgagtc agagtcagca aggtcagact gacagccaac agcagcaagc caatgacgac       240
     agtactgtga cagagattga tagaggccag ggctaccgtc agttatcgac aattgctcca       300
     gaagagcatg tcttttctcg gttagatttg gtaaagtatg attgtccatc tcttgcgcaa       360
     aagattcagt acatgttgca acaattggag ttcaagttgc aagtcgaaag acaataccag       420
     gaagctaaca ataaactaac gaaactgtac caaattgatg gtgatcaacg cagtagttct       480
     gctgctgaag gtggcgcctt ggaatccaaa aatagagtcc aacttcttaa gaaagcatta       540
     aagaaatatc aggctataaa tgttgactta gaccagtact ataagcatca taatgatgaa       600
     tccttaaaag acatgcagcc aaagctaagg gaaaaacaat taactggtat gctaacaatc       660
     ggaatcactg cgattagaga tgtggatcac attcagtcgc cattgtttgc tagaaatcct       720
     gaaactttca taactgtaaa gattgatgat gttgtcaaaa gtagaactaa accttccaga       780
     aacgatcgtt ggaatgaaga gttctctata gaagttgaca aaggtaacga aattgaaatt       840
     acaatttatg atagagttaa cgaatctgtg actcctgtag ccgtgatgtg gctgttacta       900
     tctgatattg cagaagagat acgtaagaaa aaagtaggaa agacaaatgg tcaaggctgg       960
     gtccgtgcgg caagcattaa gtcacagact gtgcacaaca gtcaggcagt agcaaataga      1020
     acatatgcaa gtgactccag aaccacatct ttgaataata gtaactcaga tcttaatcaa      1080
     gatatgtcat tgtctccaac acaagtaaca actaatgcat ggtttgttct tgaacctgct      1140
     ggtcagattt tattgacatt gggtttccat aaaacttcgc aacatcaaag aaagaatttg      1200
     gtaggtggtc tacatagaca tggtgcaatc attaacagaa aggaagaagt ttatgaacag      1260
     cacggtcatc actttgtgca aaaatcattt tacaatatta tgtgttgtgc ttattgtggt      1320
     gacttcttga gatatactgg tttccaatgt caagactgta agtttttatg tcacaagaaa      1380
     tgttatggga atgttgttac taaatgtatt tcaaaagcaa gtacggaaac tgatccatct      1440
     gaagcaaaat tgaaccatca tattccacac agatttgagc ccgtatctaa tagaggtact      1500
     aagtggtgtt gtcactgtgg ttacatttta ccatggggta aacaaaaggt caggaaatgt      1560
     accgaatgtg gtatcatgtg ccatacacaa tgtgcacatc ttgttcctga tttctgcggt      1620
     atgtcaatgg aaatggctaa taaaatcttg aaaactatcg aagatacgaa gcgtacacaa      1680
     gaaaagaaaa agagaaaacc tcctcaaaca aatgcttctg cattaacctc cacttcaacc      1740
     atgattggta gttccgttca tgatcgtttg gattcatcgc caagcaagtc aatgaatgca      1800
     tccattccat ctatcccatc accaagaaag catccttatg ctgctaatca atatcatgaa      1860
     aaggctgaag agcatcaaat gcaaaatcag aatagattga acaactatat cgaagataat      1920
     gaagcatatc tgaagtttac ttctggtgtt ggagttcctg gagcatcgca agatgtgaag      1980
     gcacaaaata tgaacgatgc atatgttgat cagtatggtc atgagtacca gcaagataac      2040
     aacgactccc aactgaaagc aagtgaggat gaactggaat tatggaagca acatagagag      2100
     agaatggaga gagagcttca acaagagcag caaatgcaga tgagctatga taataatgct      2160
     gaaggtcaga tagatttgta tactaaacaa gcatcaggtg atgtaaatat gttgcctgca      2220
     gtcgacgaga cagtatcatc acataacaat ccattcagag atatgaatca tgagacattt      2280
     gaacaaacac agaattatgt tgctaatcaa ttacagggtg atgttacaga catccggtca      2340
     agtactgaaa tcatcaccgc agcaggtaat aatgtatctc ctcagaagcg ttccagtggt      2400
     aagcataaga agaggggttc taagcgtcct aaggtatcct tagataattt tgtgctacta      2460
     aaggttcttg gtaaaggtaa cttcggtaaa gttatacttt ctagatcgaa gaacacgaat      2520
     aggctttgtg ccattaaagt tttgaaaaaa gataatatca tccaaaatca tgacatagaa      2580
     agcgctagag ctgaaaaaaa ggtatttttg ttggctacta aaactaaaca tccattttta      2640
     acaaatctat attgctcatt ccaaacagag aatcgtatct attttgcgat ggaattcatc      2700
     ggtggtggtg atttaatgtg gcatgtgcaa aaccagcgtt tatcagtcag gagagctaaa      2760
     ttttatgcag ctgaagtatt gcttgctcta aaattcttcc atgataatgg ggttatttat      2820
     cgtgatttga aactagaaaa tatactgttg acacctgagg gtcatataaa gatagcagac      2880
     tatggtcttt gtaaggatgg tatgtggtat ggtaacaaga cttctacatt ctgtggtaca      2940
     ccagaattta tggccccaga acttttgaga gaacaagatt acacaaaggc tgttgattgg      3000
     tgggcatttg gtgtgttgct ttaccaaatg cttctatgtc aatcaccatt ttctggtgac      3060
     gatgaggatg aagtgttcaa tgccatcttg actgatgagc cattgtatcc gattgatatg      3120
     gctggcgata tagtccagat attccaaggt ttgttaacaa aggatccaga aaagcgtcta      3180
     ggtgctggtc cccgcgacgc tcttgagatt atggaggagc cttttttcag aaatatcaat      3240
     tttgatgatc tattaaacct acggatcaag ccgccatata tcccagaaat taaatcagct      3300
     gaggatactt cgtacttcga acaagaattc acttcagcac ctccatcatt gacaccgtta      3360
     ccttccgttc tatccacgac ccaacaagag gagttccgtg gattttcata catgccagaa      3420
     gatctagaat tatag                                                       3435
//

If you have problems or comments...

PBIL Back to PBIL home page