(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE408

CAGLA1_12.PE408      Location/Qualifiers
FT   CDS_pept        complement(935685..937040)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066067" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440098"
FT                   /locus_tag="CAGL0M09405g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62731.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG124122"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI00003B716E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ41"
FT                   /transl_table=1
FT                   /translation="MEINNEDHELLAEIMGHGGDGSELFGNDADVFLRNGSGSGETQAG
FT                   NADGLALYPQATPAHRHEQMAMMNHGNSEMHSFLDDMFTNSSLGHGQPVTESNLTKNMM
FT                   GNHYEQNLESDIASSLYNSRHPSVSMEHGTAGHPEMLFHQNDNSISSFSESFYGSSLDS
FT                   SISEVSSINSFMSGNSFPAPLPHQIDENSILVNNNMSPSGFRDSIRPGSFLSTSLRAPS
FT                   SMSRQMRNPSYNDSGIPMTVGSVPKNATSHMTPDEKLKRKREFHNAVERRRRELIKQKI
FT                   KELSKLVPPSLLNYDADGNQIKSNRGTILDKSVEYLEYLLYVIDIQKRKREALQEKIAQ
FT                   LSSLSSRTTDDLGMGPRKMTNLPQRISSQATLKANTFNEEKIIDTRGIPDTRGISASQA
FT                   HTDNPLEDFNHNHVDFNATHTDFNNNINDDLQQFLSGDLMEAEDNAKLMFNP"
     atggagatta acaatgagga ccacgagctg ctagcggaga ttatgggcca tggaggtgat        60
     ggttctgagt tgtttggcaa cgatgctgat gtgtttctgc gaaatggctc tgggtctggt       120
     gagacacaag cagggaatgc tgatggactg gcgttgtatc cgcaggctac acctgcacac       180
     cgccatgagc agatggctat gatgaatcat gggaacagcg agatgcactc cttcctggac       240
     gatatgttta cgaattctag tttgggccat ggacagcctg ttactgagtc aaatctgacc       300
     aagaacatga tgggtaacca ctacgaacaa aatttggaaa gcgacattgc atcatctttg       360
     tacaatagca gacaccccag tgtgagtatg gagcacggca cagcgggaca cccagaaatg       420
     ctgttccacc aaaacgacaa cagtatatcg agtttctcgg agtcgttcta cgggtcttct       480
     ctggactcta gcatttctga agtatcctcg attaacagtt ttatgtctgg gaactcgttt       540
     cctgctcctt tgccacacca gatagatgaa aactctatac ttgtgaacaa taacatgtcc       600
     ccctcggggt ttcgtgacag cataagaccg gggagctttt tgtcgacttc actgcgggcc       660
     ccaagttcta tgtcccgcca gatgcgcaac ccgtcatata atgactcagg catacctatg       720
     actgttggca gtgtgccgaa gaatgcaact tcgcatatga ctcctgatga gaaattgaaa       780
     cgtaagaggg agtttcataa cgcagtagag cgcagaagaa gagaactaat aaaacaaaag       840
     ataaaagaac tctcaaagct agtaccacct tcgttgttga actatgacgc cgacggtaat       900
     caaatcaagt ctaatagggg aacaatcctg gataagagtg tagagtacct agaatactta       960
     ctatacgtta tagatattca gaagaggaaa cgggaagcat tacaggagaa aattgcccaa      1020
     ttatcgagct taagcagtag aacaactgac gatctgggta tgggaccacg caaaatgact      1080
     aatttacccc agaggatatc ttcacaagct acacttaagg caaacacatt caatgaagag      1140
     aagataattg acactagagg gatccctgat acaagaggga tttcagcatc acaggctcat      1200
     acagataacc cattggagga tttcaaccat aaccatgtcg actttaatgc cacccacaca      1260
     gatttcaata ataatattaa cgatgactta cagcagttcc tgtcagggga cttaatggaa      1320
     gcagaagaca acgcaaagct aatgttcaac ccgtaa                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page