(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE409

CAGLA1_12.PE409      Location/Qualifiers
FT   CDS_pept        937627..938268
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233384" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440099"
FT                   /locus_tag="CAGL0M09427g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="vesicle-mediated transport "
FT                   /protein_id="CAG62732.1"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG244788"
FT                   /db_xref="HOGENOM:HBG323920"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="InterPro:IPR011691"
FT                   /db_xref="UniParc:UPI00003B716F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ40"
FT                   /transl_table=1
FT                   /translation="MTDNNDQVNLLRDSLSRWNQGRAQQSQGFNESAKTLFSSWADSIN
FT                   ERAQDVYSRLPVSRQDLIQDEEPAWFNLSRTERLILFVCFILGSAACFTLCVFLFPVLA
FT                   IKPRKFGILWSVGSLLFVLAFGIFQGPVAYIKHLTSRERLPFTVFFFGTCALTIYFAAF
FT                   MKSTILTIPCAVLELIAVLYYAISYFPFGGTGLRMLSSFGINTARGALHI"
     atgactgata acaacgatca ggtcaatttg cttagggact cgctgagcag gtggaaccaa        60
     ggccgggcac agcaatcgca agggttcaac gagtccgcaa agacactgtt ctcctcatgg       120
     gcagattcta tcaatgaaag ggctcaagac gtctattcca ggctgcctgt ttccagacaa       180
     gaccttattc aggatgagga gcctgcttgg tttaacttgt cacgcacaga gaggttgatc       240
     ttgtttgtgt gtttcatatt gggttccgct gcatgtttca cactatgtgt gttcctgttc       300
     ccggtattgg ccatcaagcc taggaagttt ggtatacttt ggtctgttgg ctcattgctt       360
     tttgtgttag cctttggtat attccaagga cctgttgcat atatcaagca tttaacctct       420
     agggagagac tcccttttac tgtgttcttc tttggtactt gcgcattgac catctacttt       480
     gctgccttca tgaaaagcac tatactcacc atcccatgtg ctgtgctaga gcttattgct       540
     gtgttatatt acgctatatc atatttccca tttggcggca ctggtctcag aatgctcagc       600
     tcattcggta ttaacacggc tagaggcgcg ctacatatat ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page