(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE41

CAGLA1_12.PE41       Location/Qualifiers
FT   CDS_pept        complement(109609..115548)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246755" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436697"
FT                   /locus_tag="CAGL0M00990g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62365.1"
FT                   /db_xref="HOGENOM:HBG059089"
FT                   /db_xref="HOGENOM:HBG396727"
FT                   /db_xref="UniParc:UPI00003B7008"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK55"
FT                   /transl_table=1
FT                   /translation="MSLPIAQLYEKAGQFVPLIEKVYNGSNVGISESKLLGDVLHFIAE
FT                   LKDQHIFCDPQFEPIAVFCLTIFSFNDQSTIDWLKSRFNSILASCNKCVLAFARGKSRM
FT                   LRHFAIQRNVPHEHVAKFNNLICSWRLDTIRVPIEKLSNLPIGSQVENDFSCAFYECMT
FT                   DPNLMRMDRAFRALFDKSFSVLLSSQDSLLNGKTPNDGDILLAGTIFCWCEGNKDENDW
FT                   ARKVLRNLIQSKTTFNMKTIGDDVLDEIQTHFLFLQNPGNWNEVIVSQFWTRFIPIFTM
FT                   LDREIIEEYFGIPKNQESLKRSFKYPIESLVKLWCNHMTKLYSDKPVDFLLRALHMFLD
FT                   KLGQDFWQLIEPYTFHSILDSLFEQPVFLARLMRLQKEPIIENREELIFSFSGSLTDLL
FT                   AWTLPFYNALSPSKRIQMVKKVSISFLKIVAHQPNLESISKACLVTSSCTLLSSVLFIT
FT                   DDERAKLYSVNDFENVLLTKVDSRLLLDNSLIQNVLLKSITEPASFYPGLGNSATSVAA
FT                   STMGVLTTCIDFDLLTLCQRTYKLYFGTAVNEFPLPLSLLENMVGSIQLGSFHNGPLLT
FT                   KLLLTSLKNVYGIVIITKSNLNTTQHNKTVENVWNLVINLVENFNDLLPNQLMEILGDK
FT                   DAMVGFWSCIFSSNEKLYQAATNILYNTFDVDGRLEGVQALFKQNVSSHLNSINFILSK
FT                   LIKCEYFELCPRTVKVLMDIISAFIDPTNGVLSNPEISNSSETKDEMFSFWNLVWSFLD
FT                   SIYRCTLKWATKYNYSLLENFTKDTLDLSNALVGSFREFKDVLGENVNLFHVVLKAFKN
FT                   MLYWLRLSDEILLESCVKLITSTSDLAQERKMKFDDELVELMAKYGSKYRKFSNKLSLQ
FT                   QSNEIISRAQTLNPTLTSKIMDEASAYNKMKEQAKQTIVISDSEETGTGKSPAELKSEY
FT                   LQRKALGLAAHTKSKVTQSKITSFGTVQAGAALSLKTKPQPKPLSKMEMARRQLLQNRV
FT                   IHPPSQPAFHTKAPSKSQTAEDDTSSDESDIDMETARELFAVAKSKSKGIETLDISGKP
FT                   IKINSAAERAKMEEEYMRKRLNVDLNPLYEQLLQWDYTKISEYPDDKGADAYRDIKDEF
FT                   KSANDYKNVMKPLLLLESWQGMCSARDRDENTPFSIVIGNRTSISDFYEIYASISKKML
FT                   QDSNITESDLIVLAYFPNIAPGQKVRYEEFKKAQFTCLAKVKTLKKTKGGNVDMSLRVH
FT                   RNHSFAKYLTHRAEINAVKVMQMTTIEREYSTLEALQYYDLVNQILSAKLSPPSNTFEQ
FT                   QIMKVQQEYFLNESQARAIVNTVISSGFSLIQGPPGTGKTKTILGIVGYFLSLRNATPT
FT                   GTIQAPTDKKSTTLDQMLKKPKILICAPSNAAVDEICLRLKSGIKTKGQTVRPAIIRLG
FT                   RTDVVNAELKDVTLEEIVDKKLGDKSYEFTNNPDIEKKFQSLLSERRQLRDKLNAENGS
FT                   PDSSMSTNDIANLQMKIRELTKSINELGREKDEMREKNAINYRNRDLDRRNAQAQVLAS
FT                   CDIICSTLSGSAHDVLATLGMKFETVVIDEACQCTELSAIIPLRYGSKRCIMVGDPNQL
FT                   PPTVLSGAASNFKYNQSLFVRMEKNSKPFLLDVQYRMHPAISKFPSAEFYDGRLMDGPD
FT                   MESLNKRIWHEQEPFKPYKFFDITSGQQVQNVKTMSYTNKEEIEVAIEMVDKLFRLYDN
FT                   KIDFSNKIGVISPYKEQIQRMRREFMRYFGGSITKFVDFNTIDGFQGQEKEIIIISCVR
FT                   ADDSQSGVGFLKDFRRMNVALTRARTSIWILGHQKSLRKSKLWSHLIDDAEGRGCLQQA
FT                   YSGFLNSSNSRAQDTLNKYKESKSKEKKKHPIPAAADKKDADISNRNISEATDISDGED
FT                   DYDPVTAFKPIEKIAIKRRADNQDKSPFIEKKRIKKPKIQANDENPSGTKKKSSIFGSK
FT                   ENNQVPSKPAVPYIKDKASKKDKKEDKKKSKKSRHISFSDSIETIP"
     atgagtttgc cgatagcgca gctttacgaa aaggctggtc aatttgtgcc cctgattgag        60
     aaagtctaca atggaagcaa cgtaggtata tcggagtcga agttgttggg agatgttttg       120
     cacttcattg cagaattgaa ggaccagcat attttttgtg atccacagtt tgaacctatc       180
     gcggtattct gccttactat attctccttc aatgaccagt ccactattga ttggttgaaa       240
     tcgcggttca actcgattct ggcgtcttgt aacaagtgtg tcttggcatt tgcaagaggt       300
     aagagccgaa tgttgagaca ttttgcaatc caaagaaacg taccacatga acatgtcgct       360
     aaatttaata acctcatctg cagctggcgc ttagatacca ttagagtacc cattgaaaaa       420
     ctgagcaatc tgccgatagg ttcacaggta gagaacgact tctcctgtgc tttttatgaa       480
     tgtatgactg atccaaactt gatgagaatg gatcgggcct ttcgtgctct gtttgacaaa       540
     tctttctccg tgttgttatc cagtcaagat tctctattga atggtaaaac accaaatgac       600
     ggagatatcc tgcttgcagg tactatattc tgctggtgtg aaggaaataa ggatgaaaat       660
     gattgggcta ggaaagtact gcgaaaccta attcaaagca aaacaacgtt taatatgaag       720
     accataggtg atgacgtact ggatgaaatt caaacacatt ttcttttctt acaaaatcca       780
     ggtaactgga atgaggttat agtttcgcaa ttctggacac gatttattcc aatcttcacc       840
     atgttagatc gagaaattat tgaggaatac ttcggcatac caaaaaatca agaatcactg       900
     aaaagatcat ttaagtaccc aattgaatct ttggtaaaac tgtggtgtaa tcatatgacg       960
     aagttgtatt ctgataagcc tgtagatttc ttgcttcgag ctttgcatat gtttctggac      1020
     aaacttggcc aggatttttg gcaacttatt gagccatata catttcacag tattttagat      1080
     tctttatttg aacaaccagt cttcttggct agacttatga gattacagaa agagcctatt      1140
     atagaaaatc gtgaagaact aatattttca ttttcaggtt cattgacaga tttactagct      1200
     tggactttac cattttacaa cgcgctttct ccatcaaaac ggatacagat ggtcaagaag      1260
     gtgtcgattt cttttttgaa aatagttgca catcaaccaa atttagaatc tatatccaaa      1320
     gcctgtttgg ttacttcttc ttgtacgcta ctgtcttcgg ttcttttcat cacagatgat      1380
     gaacgagcaa aactttattc tgtgaacgat tttgaaaatg ttttattaac caaagtggat      1440
     tctcgtctct tactagataa ttcattgatc caaaatgttt tactaaaatc gattacggaa      1500
     ccagcgagtt tttatccagg tttaggtaat tctgctacat cggttgctgc atctactatg      1560
     ggggttctta caacatgtat tgacttcgat ttgttaactt tatgtcaaag aacttataaa      1620
     ttgtattttg ggacggcggt aaacgaattt cctcttccat tatcattact ggaaaatatg      1680
     gtcggtagta ttcaattggg atcgtttcat aatggacctt tactaaccaa attgctgctt      1740
     acttcactaa aaaatgttta tggtattgtg attattacta agtcgaattt aaatactaca      1800
     caacataata agacagttga aaatgtctgg aacttggtaa taaatttggt tgaaaatttt      1860
     aatgatttac ttcctaatca actaatggaa atattaggcg acaaggatgc tatggttggt      1920
     ttttggtctt gtatttttag ttcgaatgaa aaactgtacc aagccgctac aaatatactg      1980
     tacaacacat tcgatgttga tggtagattg gaaggtgtgc aggcgttgtt taaacaaaat      2040
     gtttcttcac atctgaactc catcaatttt attctctcga aattgatcaa atgtgaatac      2100
     tttgaactat gtccaagaac agttaaagtg ttaatggata ttattagtgc attcattgat      2160
     cctactaacg gtgtactaag taatccagaa atttctaatt catcagaaac taaggatgaa      2220
     atgtttagtt tttggaattt ggtttggtca tttttggatt ctatttacag atgtacatta      2280
     aagtgggcga caaagtataa ctactcttta ttagagaatt ttacaaaaga tactcttgat      2340
     ctaagtaacg ccttggttgg atcatttaga gaattcaaag atgttttggg tgaaaatgta      2400
     aacctctttc atgttgtgct aaaggctttt aaaaatatgc tttattggtt aaggctaagt      2460
     gatgaaattt tattagaatc atgtgttaaa ttgattacta gtacatcaga tcttgctcaa      2520
     gagcgaaaga tgaagtttga tgacgaactt gttgaactaa tggcgaaata tggatccaaa      2580
     tacaggaaat tttccaataa actttcattg cagcagtcta atgaaattat cagtagagct      2640
     cagacattaa atcctacttt aaccagtaaa attatggatg aagcatctgc atataataaa      2700
     atgaaggaac aggccaaaca aacgattgtt attagtgatt ctgaagagac gggtactgga      2760
     aaatcacctg cagagctaaa gtctgaatac ttgcaaagaa aagctcttgg tctggctgca      2820
     catacaaaat ctaaggtaac gcaatctaag atcacatcct ttggtacagt tcaagctggt      2880
     gcagcattaa gcttgaagac caaaccacaa cctaaaccat tgtctaaaat ggagatggct      2940
     agaaggcagt tgttacaaaa tagggttata catcctccaa gtcaaccagc atttcatact      3000
     aaagcgcctt caaaatctca aactgcggaa gatgatacta gtagtgatga aagtgacatt      3060
     gatatggaaa ctgcaagaga attatttgct gttgccaaaa gtaagtctaa gggtattgaa      3120
     acattagata tttctggtaa gccgataaaa ataaatagcg ctgctgaaag agcaaaaatg      3180
     gaagaagagt atatgagaaa gagattaaac gttgatttga atcctttata tgagcagtta      3240
     ctacaatggg attatacaaa aataagtgaa tatcctgatg acaaaggtgc tgatgcctat      3300
     cgtgacataa aagacgagtt taaatctgct aatgattata agaatgtcat gaagccttta      3360
     ttgcttctgg aatcatggca aggtatgtgc tctgcaaggg acagagatga aaacacacca      3420
     ttttcaattg ttattggtaa tagaactagt atttcagact tctatgagat atatgcatca      3480
     atcagtaaaa aaatgttaca ggacagtaac ataacggaat ccgatcttat agtcttagca      3540
     tatttcccaa atattgcacc aggacaaaag gtaagatatg aagaatttaa aaaggcgcag      3600
     tttacttgtt tggctaaggt aaaaaccctg aagaagacaa aaggtggtaa tgtagatatg      3660
     tctctgagag tgcatagaaa ccatagcttt gccaaatatt tgactcatag ggcagaaatc      3720
     aatgcagtca aagtaatgca aatgacaaca attgagagag aatattccac tctggaggct      3780
     ttacagtatt atgatttggt taatcaaatt ctgtctgcaa aactttctcc gccatctaat      3840
     acatttgagc aacagattat gaaggttcag caagaatatt tcctgaatga gtctcaagct      3900
     agagcaattg tgaatactgt tattagtagt ggtttctctt taattcaagg tccacctggt      3960
     actggtaaga ctaagacaat tttaggtata gttggttatt tcttatctct aagaaatgct      4020
     acaccaacag gaaccatcca agcacctacc gataaaaaat ctaccacctt agatcagatg      4080
     ctaaagaaac caaagatatt gatttgtgct cccagtaatg cagcagtcga tgagatctgt      4140
     ttacgtttaa agagtggtat caaaacaaaa ggacagactg ttaggccggc tataattaga      4200
     ttaggtcgta cagatgtggt aaacgcggaa ttaaaggatg tcacattaga agaaatcgtt      4260
     gacaagaaac ttggggataa gagttatgaa tttaccaata atcctgatat tgagaaaaaa      4320
     ttccaatcac ttctctccga aagaagacaa ttaagagata aattaaatgc agagaatgga      4380
     tctccagata gttcaatgtc aacaaatgat atagcaaatc tccaaatgaa gataagggaa      4440
     ctaactaaaa gtatcaatga attgggacgt gaaaaggatg aaatgagaga gaaaaatgcc      4500
     attaattaca gaaatcgtga tctggataga cggaatgctc aagcccaggt acttgcctca      4560
     tgtgatatta tctgctcgac attatctggt tcagcacatg atgtcctagc tacattggga      4620
     atgaaatttg agactgtcgt tattgatgaa gcatgtcaat gtacagaatt atcagcaatt      4680
     attccacttc gatatggcag taaaagatgt attatggttg gtgatccaaa tcaattacct      4740
     ccaactgttt tatctggagc agctagtaac ttcaagtaca atcaatcctt gtttgtaaga      4800
     atggaaaaaa attcaaagcc atttcttttg gatgttcaat atcgtatgca tcccgctatt      4860
     agtaaatttc cttctgctga attttatgat ggccgcctga tggatggtcc tgatatggaa      4920
     tcattaaata aaagaatatg gcatgagcaa gagccattta aaccatacaa attttttgac      4980
     ataaccagcg gtcagcaagt tcaaaatgtt aaaaccatgt catatactaa taaagaagaa      5040
     attgaagttg caatagagat ggtcgataaa ctatttaggc tttatgataa caagattgac      5100
     ttttctaaca agattggagt tatatccccg tataaggagc aaattcaacg aatgaggaga      5160
     gaatttatga gatattttgg aggttccatc acgaaatttg tcgatttcaa cacgattgat      5220
     ggtttccaag gtcaggaaaa ggaaattatt attatatctt gtgtccgtgc tgatgactcg      5280
     caaagtggtg ttgggttttt aaaggatttc agaagaatga atgttgcatt aaccagagct      5340
     agaaccagta tatggatctt gggtcatcag aagtctttga gaaagagtaa actgtggtct      5400
     cacttgatag atgacgctga aggaagaggt tgtttgcagc aagcctattc tggctttttg      5460
     aatagttcaa atagcagggc ccaggataca ctgaacaaat ataaagaatc caaatcaaag      5520
     gaaaagaaaa agcatccaat tccagcggct gccgataaaa aggatgctga tatttctaat      5580
     agaaatattt ctgaagctac cgacatctct gatggggagg atgattatga tcctgttacc      5640
     gcctttaaac cgattgaaaa gatagcaata aaaagaaggg ctgataatca agacaaaagt      5700
     ccatttattg agaagaaaag aattaaaaag ccaaaaatac aggcaaatga tgaaaaccca      5760
     tctggaacaa aaaaaaaatc ctcgatattt ggatcaaagg agaataacca agtgccttca      5820
     aagccggcag ttccatatat taaagataaa gcttcgaaga aagataagaa agaagataaa      5880
     aagaaatcaa aaaaatcgag acatatcagt ttttcagact ctatagaaac aataccatga      5940
//

If you have problems or comments...

PBIL Back to PBIL home page