(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE410

CAGLA1_12.PE410      Location/Qualifiers
FT   CDS_pept        complement(938424..941660)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196348"
FT                   /locus_tag="CAGL0M09449g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62733.1"
FT                   /db_xref="HOGENOM:HBG124123"
FT                   /db_xref="HOGENOM:HBG204118"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="UniParc:UPI00003B7170"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ39"
FT                   /transl_table=1
FT                   /translation="MVSSSSSRRRSSTIKSALSSLLHGHSNGSGHHGKDSAYARRHSTN
FT                   SISANGSDTSVRSKLSSHGTGSAANARVPSRTPNKSSTMPDVQSNSTGHLNDTMRNTRY
FT                   DSTRYSRSFATDDENAIEFDDQNTSLNSDPSGLTPLPESFNKEYLAEYLHNRGFLNPKS
FT                   VETRENFSIGIATSGDVIFLPTVSSNDDEYLARLNGVGSGESNMELDQGAMDDELTGDD
FT                   FVIQDGVLQRQQQNQGHSATDNSSSTAVASPSGTQSDVPDSGAYQNRSLEFDASMVSFS
FT                   VAVILSVKSPIKLTDLKVELSSRVRIYWHAGVPPTKTFFEEFYQAGYVNWNLNDTNYDV
FT                   FVPTTVSSNTQIVERHNNTPTKIFRNKPISERYYTDKSKLKRQYLDSLLDCEGHLLEAG
FT                   DYVYLLPVIFSNHIPESTYLPSARISYKLKIGTRAIGSSIKRAGSTGSSLSIGQQNQPI
FT                   SSHSSTSSLSSLRDMDHEGKANSSASPHKGLSGNLLKKVKNHLHLPHNQVKPGEIEESR
FT                   ELYTEYPIKVIRTPPPISISTANKPIYINRVWSDSLSYEISFASKYVSLNSRVPIKIKL
FT                   APIAKNICVKRVRVSITEKITFVSKNLEYEYDQVDPVAKDPYNPYYLDFTSKRRKERNL
FT                   ALLEVRTKPKGSRALREEIVENCVNDNLLSFGEIKEPGKADSIPLVEPVSIETRLDFPS
FT                   YMDLDKRHAKNIPPYGIDVYTAIANPEEQQSTSHHKSSVIGILTGIKNSTDSGSSPSKA
FT                   NSDKNTNNSSSAETESAARRQTVSRFHQTSIKANSHPNVKFHTRLNKCKRGLYLDSLHY
FT                   TNVHARHKLEVMLRISKPDPENPSKLRHYEVLIDTPVFLVSDQCNTGNMELPTYDMATT
FT                   VTSTDLTPIPNATNLAPPPTFEEAISVPASPFQSPAASPIGSPVMSPSYDPELLSIQQL
FT                   NLSRSTSFSGPSVHLENTNTGTGGSSVGGISLLQPGSSHRPSISAEASSGRYSNLDRLM
FT                   FASSQTSPPPPLPMDIMQGRRASDAAAVSSSYTNPEQSPRIPIIVETNPFFKKDYTLTP
FT                   RSNEPEADDNSTTPGQLPSKDPPTYEEAVS"
     atggtaagta gcagttcatc gaggagacga agttccacta tcaagagtgc tctatcgtcg        60
     ctgcttcatg gacacagcaa cgggtctggt caccatggca aggacagtgc ctacgcgcgt       120
     agacacagta caaactcgat atcagcaaac ggaagtgata ctagtgttag aagcaaacta       180
     agtagtcatg gtactgggtc ggctgctaat gcgagagttc cttcaagaac accaaataag       240
     agttcgacaa tgcctgatgt tcagtcgaac tccacagggc atttgaatga tacaatgagg       300
     aatacaaggt atgattctac ccgctatagt cggtcttttg ctactgatga tgaaaatgcc       360
     atagaatttg atgaccaaaa tacttctctt aactcggatc cttctgggct caccccgttg       420
     ccagaatcat tcaataaaga gtacctggca gaatatctac ataacagagg gtttctgaat       480
     ccaaaatcag tagaaacaag ggaaaacttt agcataggaa ttgccactag tggggatgtt       540
     atatttttac caacagtttc atccaatgat gatgaatact tggcaagact taatggtgtg       600
     ggatcgggcg aatcaaatat ggagcttgac caaggggcca tggatgacga attaactggt       660
     gatgattttg ttatccaaga tggagttctc cagcgacaac agcaaaacca aggtcactct       720
     gcaacagaca attcatcttc aactgcagta gcctctccat ctggcacaca atctgatgta       780
     ccggattctg gtgcctatca aaacaggtca ttagaatttg atgcttcaat ggtgtctttt       840
     agcgttgctg ttatattatc agttaaatca cccatcaagc tgaccgattt gaaagttgaa       900
     ttatcttcaa gggtgaggat atattggcat gctggtgtac ctccaaccaa aactttcttt       960
     gaggaattct atcaagctgg ttatgtaaac tggaatttaa acgatacgaa ttatgacgtt      1020
     tttgtaccaa cgacggtatc gtcaaatact caaattgtag agagacataa caatacgccc      1080
     accaaaatat tcagaaataa accaataagt gagagatatt atactgataa gagcaaacta      1140
     aaaaggcaat acctggactc attgcttgat tgtgagggac acttgcttga agctggtgac      1200
     tatgtctatc tgttacccgt tatcttttcc aatcatattc cagaatccac atatttgcca      1260
     tctgcaagaa ttagttataa gctcaaaatc ggtacaagag caatcggtag ttcaataaaa      1320
     agggctgggt caactggcag ttctttatct attggccaac aaaatcaacc aataagttcc      1380
     cattcatcaa cttcatcttt atcatccctt agagatatgg atcatgaagg aaaggccaat      1440
     tcaagtgctt cacctcataa aggtttgagt ggaaaccttt tgaaaaaggt taaaaatcat      1500
     ttacatttac cgcataatca agtaaagccc ggagaaattg aagagtcaag agagctgtac      1560
     acagaatacc ccataaaagt cataagaaca ccacccccaa tttccatatc aactgcgaac      1620
     aagccaattt atattaacag agtttggtct gattctcttt cttatgaaat ttcatttgca      1680
     tcaaaatatg tgtccttgaa cagtcgcgta cctattaaaa ttaaactagc acccattgcc      1740
     aagaatattt gtgtgaaaag agtaagagta agtatcactg aaaaaataac ttttgttagt      1800
     aagaatctgg aatacgaata tgatcaagta gatcctgttg caaaggatcc atacaatcca      1860
     tattatttag acttcacttc aaaaagacgt aaagaacgga acttggcttt gcttgaggtt      1920
     aggactaaac caaaaggttc cagagcatta agagaagaaa ttgttgaaaa ctgtgttaat      1980
     gacaatctct tatcatttgg tgaaattaag gaaccaggta aggctgactc gatacctcta      2040
     gttgaacctg tatccataga gacaagatta gatttcccta gctacatgga cttggataag      2100
     agacatgcta agaatatccc gccttatggt atcgatgttt atacagcaat tgctaatcct      2160
     gaagagcaac aaagcacttc tcatcataaa tctagtgtta ttggaatact tactggaatt      2220
     aagaactcta cagactcagg ctcatcgcca agtaaggcca attctgacaa aaatacgaat      2280
     aattcatcat ctgcagaaac tgaaagtgct gccagaaggc aaactgtttc gagattccac      2340
     caaacttcca ttaaagcaaa ctctcatcca aatgtgaaat tccatacaag attaaacaag      2400
     tgtaagcgtg gtttatacct ggatagttta cattatacta atgtacatgc cagacataaa      2460
     cttgaagtga tgctaagaat cagtaaacct gatcctgaga acccctctaa attaagacat      2520
     tacgaggttt tgattgatac gccagtattt ttggtctctg atcaatgtaa cacaggtaat      2580
     atggaacttc ctacctatga catggctacg actgttactt cgacagattt aacaccaatt      2640
     ccaaatgcaa caaatttagc acccccacca acttttgaag aagcgatatc ggtgccagct      2700
     tctccattcc aatcaccagc tgcgtcccca attggatcac cagttatgtc accttcatat      2760
     gatcccgaac ttttatctat acagcaacta aacttatcaa gaagcacgtc atttagtgga      2820
     ccttctgtgc atcttgagaa cacaaacacg ggcactggtg gttcgagtgt gggtggtatt      2880
     tctttacttc aaccaggttc gtcgcataga ccttctatat ctgctgaggc aagtagtgga      2940
     aggtacagca atttagatag actaatgttt gcaagcagcc aaacatctcc acccccacct      3000
     ttgccaatgg atattatgca aggtagaaga gccagtgatg ccgctgcagt gtcctcgtca      3060
     tacaccaacc cagaacaaag tccaaggatt cctattatag ttgaaacgaa cccgttcttt      3120
     aaaaaagatt acacattgac tccacggtca aacgaaccag aggctgatga taatagcacc      3180
     acacctggcc aattaccaag caaggatccg ccgacttacg aagaagccgt ttcatag         3237
//

If you have problems or comments...

PBIL Back to PBIL home page