(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE411

CAGLA1_12.PE411      Location/Qualifiers
FT   CDS_pept        complement(942333..942659)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000034134" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440100"
FT                   /gene_name="ATG16"
FT                   /locus_tag="CAGL0M09471g"
FT                   /product="Autophagy protein 16 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasmic membrane-bounded vesicle "
FT                   /cellular_component="vacuole"
FT                   /protein_id="CAG62734.1"
FT                   /db_xref="GO:0005773"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016023"
FT                   /db_xref="HOGENOM:HBG059479"
FT                   /db_xref="HOGENOM:HBG104155"
FT                   /db_xref="InterPro:IPR013923"
FT                   /db_xref="UniParc:UPI00003B7171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ38"
FT                   /transl_table=1
FT                   /translation="MLAERDTLEKNYCELFEVPVDGRSNDGDAMLLQEALRGKDNEIRM
FT                   LEERLAVSSKNVERLNDELLGANLEANVLGQKLQDLQQEHDKLLERWMQRVRVEVDKMN
FT                   AQLE"
     atgcttgcgg agcgggatac gctggagaag aactactgcg agctttttga agtaccagta        60
     gatggtagat ctaatgatgg tgatgctatg ttgttgcaag aggcattgcg tggcaaagat       120
     aatgaaatcc ggatgttgga ggagcggttg gccgtgagca gcaagaacgt cgaacggctg       180
     aacgacgagc ttttaggcgc taatttggag gccaatgtgc tgggtcagaa gctgcaggat       240
     ctacaacagg agcacgacaa gctgttggag aggtggatgc aacgtgtgcg tgtcgaagtt       300
     gacaagatga acgcgcaatt ggagtaa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page