(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE415

CAGLA1_12.PE415      Location/Qualifiers
FT   CDS_pept        complement(947542..949797)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246707" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196349"
FT                   /locus_tag="CAGL0M09559g"
FT                   /product="Condensin complex subunit 2 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome condensation"
FT                   /biological_process="mitosis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62738.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0030261"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG060118"
FT                   /db_xref="HOGENOM:HBG396937"
FT                   /db_xref="InterPro:IPR022816"
FT                   /db_xref="UniParc:UPI00003B7175"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ34"
FT                   /transl_table=1
FT                   /translation="MLANLEEWIKMATDNKINSRNSWNFALIDYFYDLNILKDSENNIN
FT                   FQKASATLDGCVKIYSSRVDSVTSETGKLLSGLSQRKNEQANSKNNKQPGDGNDGDYDD
FT                   ADSSVQIDALTGLPVGKDSDEYLKRRRVHNRVLETTLVEFDNIRMKELDQELNIDPLFK
FT                   KALVDFDEGGAKSLLLNTLSIDESGRVVFDAAMKNEPSLLKEKESNEEPLNENNLPLDS
FT                   SKSMDEDNSHGDRSDKNSTPTPQTPITEPEEEEDSKADITLNKSFSSNFQYSMDDEILA
FT                   LGIDYIKFDDISTSDISPSLQNLRNVIADINKAKGFIDSINNKFDNFLTEDEIKEAVPE
FT                   EEGPNGNDYDDGINQELEYSMGNNEDVLPFDINDGGDNFGEDNEGGIDDEEGDENGGLD
FT                   SMLGSILEKDLMAYFDEKMNRNWRGREHWKVANYKKANTIDNKSSEPNNEIEREATESE
FT                   GTSEENKKSDTKKERKKQIQIDFLNLDPNIESIVFDSKKRSGIDMAIKSRTNDSHYLLP
FT                   DDYHFSTEKITGLFIKPNTKMSIFNRVKRRKMTAAQVDTTSDNLGNGIPQIADEQFWAN
FT                   NYEEQENENNIGGNNDLESSNIVGADIENPFEEEGIDFNQAFEDMSLDENDDAGKDIFT
FT                   QKDEKEDLTKLRQPDKVTYSRVSKKVDVRRLKKNIWMSVKSVVSQLDETSDILQFRFTD
FT                   ITKNLGKFYSPESLSDISTSFCFICLLHLANEHGLQIKSTENYEDLTVIFDKSVVTV"
     atgctggcga atttggagga gtggatcaaa atggctactg ataacaagat caactcccgg        60
     aacagttgga attttgcatt gatcgactat ttttacgacc tgaatattct aaaagactct       120
     gagaataata taaattttca gaaagcatct gctactttag atggttgtgt aaagatttac       180
     tcttccagag tggattctgt tacttcagaa acgggcaaac tactaagtgg cttatctcag       240
     cggaagaacg aacaggctaa tagtaagaat aacaaacaac ctggtgatgg gaatgatgga       300
     gattatgatg atgccgacag tagtgttcaa attgatgctc taacagggtt acctgtaggt       360
     aaagattcgg acgagtattt gaagagaaga agagtacata atagagtact ggagacaacg       420
     ctggttgaat tcgataacat aagaatgaaa gaactagatc aagaacttaa tatagacccg       480
     ttattcaaga aagctttggt tgattttgat gaaggtggtg cgaagagttt gctgctaaat       540
     accttaagca ttgatgaatc tgggagagta gtgtttgatg cggctatgaa aaatgaacct       600
     tcattgctga aggaaaaaga atcaaatgaa gagcccctca acgagaacaa tttaccacta       660
     gattctagca agagtatgga tgaagacaat tctcatggtg atagatctga taaaaatagt       720
     acaccgacac cacagacacc aataacagag cctgaagaag aagaagatag taaagcagac       780
     ataaccttga ataaatcatt ttcatcaaat tttcaatatt ctatggatga tgaaatattg       840
     gccctaggta ttgattacat caaatttgat gatatttcca catctgacat ctctccatct       900
     ttacaaaatc tccgaaatgt catagctgac ataaacaaag caaagggctt tatagatagc       960
     ataaacaaca agtttgataa tttcctaacc gaggatgaaa taaaagaagc cgttccggag      1020
     gaagaaggtc caaatggaaa tgattacgat gatggtataa atcaagaatt ggaatattct      1080
     atgggaaata atgaagacgt actaccattc gatataaatg atggcggtga caactttgga      1140
     gaggataatg agggaggaat tgatgacgag gaaggtgatg aaaatggggg actggattct      1200
     atgcttggca gtatattaga gaaagatctt atggcatatt ttgatgagaa gatgaataga      1260
     aattggagag gtagggagca ctggaaggtt gcaaactaca agaaagccaa taccattgat      1320
     aacaaatcat cagaacctaa caatgaaata gaaagggaag caacagaatc tgaaggcact      1380
     tcagaagaaa ataaaaagag tgacaccaag aaagagagga aaaaacagat tcagattgat      1440
     ttcttaaact tagatccaaa catcgagagc atagtatttg atagtaaaaa gagatctggt      1500
     attgatatgg caataaagtc aagaacaaat gattcacatt atctactacc agatgattac      1560
     catttctcta cagaaaaaat cactgggttg ttcatcaaac ctaatacaaa aatgtcgata      1620
     tttaacagag tgaagaggag aaagatgact gcagctcaag tagatacaac atcggataac      1680
     ttaggtaatg ggattccaca aatcgcggat gaacaattct gggcaaataa ttatgaggag      1740
     caggaaaatg agaataatat cggcgggaat aatgatctgg aaagtagcaa cattgttgga      1800
     gcggatatag aaaatccatt tgaggaagaa ggtatcgatt ttaaccaagc ttttgaggac      1860
     atgtcattgg atgagaacga tgatgcaggt aaggatatat tcactcagaa agatgagaag      1920
     gaagatctga caaagttacg ccaacctgac aaggtaacgt actccagagt ctccaagaaa      1980
     gtagatgtac gaagactgaa gaagaacata tggatgtcag ttaaatctgt tgtgtcacaa      2040
     ttagatgaaa catccgatat attacagttt agatttaccg atatcaccaa gaatctaggg      2100
     aaattctact caccagagag cctgagtgac atctcaacaa gtttctgctt tatttgcctt      2160
     ttgcatttag ccaacgaaca tggcttacag atcaaaagta ctgagaacta tgaggaccta      2220
     actgtaatat tcgataaatc tgttgtcaca gtatga                                2256
//

If you have problems or comments...

PBIL Back to PBIL home page