(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE416

CAGLA1_12.PE416      Location/Qualifiers
FT   CDS_pept        complement(951054..952685)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000130111" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440102"
FT                   /locus_tag="CAGL0M09581g"
FT                   /product="Similar to uniprot|P07251 Saccharomyces
FT                   cerevisiae YBL099w F1F0-ATPase complex "
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="CAG62739.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG389886"
FT                   /db_xref="HOGENOM:HBG565875"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR017458"
FT                   /db_xref="InterPro:IPR018118"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="UniParc:UPI00003B7176"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ33"
FT                   /transl_table=1
FT                   /translation="MLSRVVLARNALRAVSRASRASRGSVVRTSARCYAAKAQPTEVSS
FT                   ILEEKIRGVSDEAQLNETGRVLAVGDGIARVFGLNNIQAEELVEFASGVKGMALNLEPG
FT                   QVGIVLFGSDRLVKEGEIVKRTGKIVDVPVGPGLLGRVVDALGNPIDGKGPIESVGTAR
FT                   AQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQK
FT                   RWNDGNDESKKLYCVYVAIGQKRSTVAQLVQTLEQHDALKYSIIVAATASEAAPLQYLA
FT                   PFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRL
FT                   LERAAKMSDKEGAGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPA
FT                   INVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLVRGER
FT                   LTQLLKQSQYSPLAAEEQVPLIYAGVNGYLDNIDLGRIAEFESSFLAYLKSNHENILND
FT                   IRDKGELTKDLLATLKSATESFVATF"
     atgttgtctc gtgttgtgtt ggcgagaaat gccttgagag ctgtttcgag agcttcgaga        60
     gcttcgagag gaagtgtcgt tagaactagt gctaggtgtt atgccgccaa ggcgcagcct       120
     actgaggttt cttctattct agaggagaag atcagaggtg ttagtgacga ggctcaattg       180
     aacgagactg gccgtgtttt ggctgtcggt gatggtattg cgcgtgtctt tggtttgaac       240
     aacatccagg ccgaggagct ggttgagttt gcctctggtg tcaagggtat ggccttgaac       300
     ttggagcctg gccaggtcgg tattgtgctg ttcggttctg acagactggt caaggaaggt       360
     gagatcgtca agagaaccgg taagatcgtc gatgtcccag ttggtccagg ccttttgggt       420
     agagttgtcg atgctttggg taaccctatc gatggtaagg gcccaatcga gtccgtcggc       480
     accgccagag cccaagtcaa ggccccaggt atcttgccaa gacgttccgt gcacgagcct       540
     gtgcagaccg gtttgaaagc cgtcgacgcc ctagtgccta tcggtagagg ccagagagaa       600
     ctgatcatcg gtgaccgtca aactggtaag accgccgtgg ccctagacac catcttgaac       660
     caaaagagat ggaacgacgg taacgacgag tccaagaagt tgtactgtgt ctacgtcgcc       720
     attggtcaaa agagatccac cgtcgcacaa ctggtgcaga ctttggagca acacgacgcc       780
     ttgaagtact ctatcatcgt cgccgctacc gcttctgaag ctgctccttt gcaatacttg       840
     gctcctttca ctgccgcctc catcggtgag tggttcagag acaacggtaa gcacgccttg       900
     attgtctacg atgacttgtc caagcaagcc gtcgcatacc gtcaactttc cctgctgcta       960
     agacgtcctc ctggtcgtga agcttaccca ggtgatgtct tctacttaca ctccagactt      1020
     ttggaaagag ctgccaagat gtccgacaag gaaggtgccg gttccctaac cgctttgcca      1080
     gtcatcgaaa cccaaggtgg tgatgtctcc gcttatatcc caactaacgt catttccatt      1140
     actgacggtc aaatcttctt ggaagccgaa ttgttctaca agggtatcag accagctatc      1200
     aacgtcggtc tttccgtctc ccgtgtcggt tccgccgccc aagttaaggc cttgaagcaa      1260
     gtcgccggtt ccttgaagct gttcttggct caatacagag aagtcgccgc tttcgcccaa      1320
     ttcggttccg atttggacgc ttctaccaag caaaccttgg ttagaggtga aagattgaca      1380
     caattgctaa agcaaagtca atactcccca ttggctgccg aagaacaagt tccattgatc      1440
     tatgccggtg tcaacggtta cctagacaac atcgacttgg gcagaatcgc tgaattcgaa      1500
     tcctccttct tggcctactt gaagtccaac cacgagaaca tcttgaacga tatcagagat      1560
     aagggtgaat tgaccaagga cctactagcc actttgaaga gtgctactga gtccttcgtt      1620
     gccactttct aa                                                          1632
//

If you have problems or comments...

PBIL Back to PBIL home page