(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE422

CAGLA1_12.PE422      Location/Qualifiers
FT   CDS_pept        complement(961939..963159)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440107"
FT                   /locus_tag="CAGL0M09691g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62745.1"
FT                   /db_xref="HOGENOM:HBG124126"
FT                   /db_xref="InterPro:IPR007846"
FT                   /db_xref="UniParc:UPI00003B717C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ27"
FT                   /transl_table=1
FT                   /translation="MFGNSAGFGSVGDNSSGGSGANRDANNRPSWFQETARRTIPNTVL
FT                   RREVKSSSNSGEDDNGNRGDSTSTGFNTLTFGAKKHMLLGSSNVSTGGNDHMNPLLMDN
FT                   SEAPPTVSISDWKREEGLFDLRNTRNENTINTIGTPTFISPISREKSEVSLFDSNSQSR
FT                   SSSASSIGSESETGNAVVVFGYREAITKQILAYFAQFGEILEDLESELGDTETMRTPGY
FT                   FFQQAPNRRRISREHGRTWTKLTYANHSSYLRALREHGTIYCGAAIGCVPYKHELISEL
FT                   SRDTYNSMNDVKQTNSISTNQLTQHNQSEVPKSNQTFETKPTNETERNQIKTPSAFGSD
FT                   NKGNGSISSGRTKRRLSIKDGSSLFLSGTDNIFSTLDGQPTKKRMINRDRSLIGKISGW
FT                   LFGWNDL"
     atgtttggga acagcgcagg ctttggatca gtgggtgata acagtagtgg tggtagtgga        60
     gctaatcgtg atgcgaacaa tagaccttca tggtttcaag agactgccag acgtaccatt       120
     ccaaacaccg ttttgcgcag agaagtgaag agtagtagta atagtggtga agatgacaat       180
     gggaacagag gagacagtac gagcacaggg ttcaacacac taacatttgg agcgaagaaa       240
     cacatgctgt taggaagttc aaatgtcagc actggaggaa atgaccatat gaatccctta       300
     cttatggata atagtgaggc acctccaact gtgtctatct ctgattggaa aagagaggaa       360
     ggtttatttg atctccgaaa caccaggaat gagaatacca taaatactat tggcacaccg       420
     acattcattt ctcccatctc tagggaaaag agtgaagtga gtttattcga tagcaattcc       480
     caatcaagat catcatcagc ctcttctata ggttctgaat ccgagacagg aaatgcagtt       540
     gtggtatttg gttatcgtga ggctataacc aaacaaattc tagcctactt tgcacaattt       600
     ggcgagatat tagaagatct agaatcagaa ttgggtgaca ctgaaactat gaggactccc       660
     ggatattttt ttcaacaggc acccaataga cgtcgcataa gcagagaaca tgggagaaca       720
     tggactaaac tgacttacgc taaccattct agctacttac gtgctctaag ggaacacgga       780
     acaatatatt gtggagctgc tattggatgt gtaccctaca aacatgagtt aatatccgag       840
     ttatctagag acacctataa ttcgatgaat gacgttaagc aaactaattc gatcagcaca       900
     aaccaattga cacaacacaa tcaatccgaa gtgcccaaaa gcaatcaaac tttcgaaact       960
     aaaccaacta atgaaaccga aagaaatcaa atcaaaactc cttcagcatt cggatctgat      1020
     aacaaaggaa atggttcgat ttcttctggt aggactaaga gaagattaag cataaaagat      1080
     ggttcttcgc tatttttgtc tggaacggac aatatattct caaccttaga tggccaaccg      1140
     accaagaaga ggatgatcaa tagggacagg tcgttaatcg gaaagatcag tggttggttg      1200
     tttggctgga acgatctata a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page