(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE424

CAGLA1_12.PE424      Location/Qualifiers
FT   CDS_pept        964915..966207
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113516" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045137"
FT                   /locus_tag="CAGL0M09735g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62747.1"
FT                   /db_xref="HOGENOM:HBG191670"
FT                   /db_xref="HOGENOM:HBG202527"
FT                   /db_xref="InterPro:IPR007150"
FT                   /db_xref="UniParc:UPI00003B717E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ25"
FT                   /transl_table=1
FT                   /translation="MKLKLEINGNDYPENFKLLKTTVTTVASLRSLAVLRFDSDRLVII
FT                   STPRVSNGVVAGHGVVARDSGELWCTIPRDVFSLYHVSAERQNNTIALECNVESLKNAV
FT                   LRYDKVMTQGSASTLQLKLRQMPEWNAASANGPDSAGNSRIRVAALAVSFEELVNVYSG
FT                   QGKDDAFMDATQNNTSHAVNKLISHSSKIPVRFLNAQQDERIQEPMMDYNQTMLCRLPS
FT                   ITDEAGGAFLNFLKRIERYTNVNHIKLQGSTSPHISHNRRDAKLRILVDELDWNLVISW
FT                   NGPLELQERADIDEMAEPTSPERPRSETPLLSRISGDNNFDRIDDSEVNTLQESGPDTN
FT                   SHTNGFLEQVQQAEDESSLVQEVIIRSKDLKVCSKLFAAFEEVIMAISHDYACVFHCSL
FT                   SRGLRDTQTQEEKENGQIIYYISRSKALEFA"
     atgaagttga agcttgagat caatgggaat gattaccctg agaacttcaa acttttgaag        60
     accactgtta ctacagtagc gtcattacgg agccttgctg tgctgcggtt tgacagtgat       120
     cggctggtta ttatatcgac gcccagggta tcgaatggtg tggtggctgg acatggtgtt       180
     gttgccagag atagtggcga gctttggtgt accattccgc gagatgtttt cagtctgtat       240
     catgtctcag cggaaagaca aaacaacacc attgcgcttg agtgcaatgt tgaatcactg       300
     aagaacgctg ttctgcgata tgataaggtg atgacccagg gatcagcgtc tactttgcaa       360
     ttgaagctcc ggcaaatgcc tgagtggaac gccgctagcg ctaacgggcc tgacagtgcc       420
     ggtaactcca ggatacgagt cgctgcattg gccgtgtcat tcgaggaatt agttaatgtt       480
     tactctggtc agggcaaaga tgatgccttt atggatgcaa ctcaaaacaa tacttcacat       540
     gcggtcaaca aacttataag tcactcctcg aagattccag tcagattctt aaatgcacaa       600
     caggatgagc gcatacaaga acctatgatg gactataacc agacaatgtt gtgcaggttg       660
     ccgtcgatta cggatgaagc tggtggtgct tttctgaatt tcctcaaaag aatagaacgg       720
     tacacaaatg tgaatcatat aaaactacaa ggatcaacaa gcccgcatat ctcacacaac       780
     cgcagagacg ccaagttgcg gattcttgtt gatgaactag attggaacct tgttataagc       840
     tggaatggcc ccttggaact tcaagaaagg gcagacattg atgaaatggc agagccaaca       900
     tcgccagaac ggcctagatc tgaaacaccg ttgctgagta ggataagtgg tgataataat       960
     ttcgatagaa ttgatgacag cgaggttaat acattacaag aaagcggtcc cgatactaac      1020
     tcacacacaa atgggtttct tgagcaagtg caacaagcag aggacgagtc ttccctggtt      1080
     caagaagtaa ttataagaag caaagattta aaagtatgct caaagctttt tgcagcattc      1140
     gaagaagtca tcatggccat ctcgcatgac tacgcctgtg tctttcactg ctccctgagc      1200
     agaggcctaa gagataccca gacacaggag gaaaaagaga atggtcagat aatctactac      1260
     atatccaggt caaaggcact ggaatttgca taa                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page