(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE429

CAGLA1_12.PE429      Location/Qualifiers
FT   CDS_pept        975007..977817
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217777" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349527"
FT                   /locus_tag="CAGL0M09845g"
FT                   /product="Similar to uniprot|Q06078 Saccharomyces
FT                   cerevisiae YLR409c"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="small-subunit processome"
FT                   /protein_id="CAG62752.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0032040"
FT                   /db_xref="HOGENOM:HBG053553"
FT                   /db_xref="HOGENOM:HBG735132"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007319"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B7183"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ20"
FT                   /transl_table=1
FT                   /translation="MSEVAKRRKLTSTKRYASKIFSPFRVIGNVSNGTPFAVGSLGSTF
FT                   YIVTSVGKSFQIYDANNLHLLFISDRETDEEISCLEAHFHYVYAGFGGKVGIYKRGILE
FT                   HTIEVGNGCKVTKLCVFGDYLCVSTDNNEVHIFKKENSTTDKYATKFYTKFEIPELVGG
FT                   DIVSVLHMPTYLNKIVVVTKINVLLYNVRSGKLLYSSPDFPDQLTVGEAAPALDIIALG
FT                   TISGEVILFNLRLGRKVRTIKVPNMRISSISFRTDGSSHICVGSSKGDILFYDLNRRAR
FT                   IHLLKNVHSEEFGGVTRASFLNGQPIIVTSGGDNSLKEYVFDPSLSQSDEDMVVQPPRF
FT                   LRSRGGHSQPATSIAFADDESHFILSASRDKSVWAFSLRKDAQSQELSQRLHKKNDGNR
FT                   VAGSTMREKFPEVSSIAIENARIGEWENILTAHNESKAARTWDMRSKRVGRWTFETIDD
FT                   GMVKSVAISQCGNFGFVGSSNGGIGVYNMQSGMLRKKYRLHKRAVTGVAVDGMNRKMVS
FT                   CGLDGIIGFYDFNESKYLGKLQMDAPITSMVYHRSSDLCAFALDDLSIVVVDTVTQKVV
FT                   RQLWGHGNRITAFDFSPDGRWLVSASLDSTIRTWDLPTGSCIDGVKIESVATNLKFSPN
FT                   GDMLATTHVIGNGIFIWTNRAQFKQISTKAIDEDAFQKIMLPNASVSGNSQFLEGAFQD
FT                   GGDDHEPLDINNYQSVEQVNSELVTLSLGPRNKMNTILHLDVIKKRSKPKEAPKKPEKA
FT                   PFFLQLAGDKVGDEASGREGISFETPEEIRAREEKQKQSEEAQAELTKFKPGTNRGFQS
FT                   KFTKLLLHGNKQNQYEEFLEYLVSMSPATLDLEIRSLNSFEPFEEIIAFISALTAGLKT
FT                   NKNYELYEAIMNLLFKAHGDVIHANNTNCDLQDALSQWETVHGTEQKMDELVKFCSSVL
FT                   DFVSRS"
     atgtctgaag ttgctaagag gaggaagctc acctctacca agaggtatgc gtcgaagata        60
     ttttctccat ttcgggtgat tggtaacgtt agcaatggga caccatttgc tgtaggcagt       120
     ttgggtagta ctttttatat cgtaaccagt gttggtaagt cttttcagat ttacgatgct       180
     aacaatttgc atcttttgtt tatttctgat cgggagactg acgaagagat cagttgcctg       240
     gaggcccatt tccactatgt gtatgctggt tttggaggga aagtaggtat ctacaaacgt       300
     ggtatattag agcacaccat tgaggttggt aacggctgca aagttacaaa actgtgtgtt       360
     tttggtgatt acttgtgtgt ttcaaccgat aataatgaag tacatatttt caagaaggaa       420
     aattcaacaa ctgataagta tgctactaag ttctatacca agtttgagat tccagaactt       480
     gtaggtggtg atattgtatc tgtattgcat atgcccacat atctgaacaa gattgttgtt       540
     gttacaaaga tcaatgtgtt actgtataac gttagaagcg gaaagctgtt atatagctct       600
     ccagatttcc ctgatcaact gactgtgggt gaagctgctc cagcacttga tatcattgca       660
     cttggtacta taagtggtga ggtgatacta tttaacttac gtctcggtag aaaagtaagg       720
     acaattaaag taccaaacat gagaatttca tccatctcat ttagaaccga cggttcttct       780
     cacatttgcg ttgggtcatc aaagggtgat atcctattct atgatttgaa ccgtcgtgct       840
     agaattcact tattgaagaa tgtacacagc gaagaatttg ggggtgtcac aagagcaagt       900
     tttctaaatg gtcagccaat aattgtcaca tcaggtggtg ataacagttt gaaagaatat       960
     gtttttgatc catctttgtc tcaaagtgat gaagacatgg tagtgcaacc accaaggttt      1020
     ctgcgttcta gaggtggtca ctctcaacct gcgacaagca ttgcttttgc tgatgacgaa      1080
     tcgcatttta ttctatctgc ttcgagagat aaatcagtct gggcattttc cttgcgtaaa      1140
     gatgcccaat ctcaggaact ttcacaaaga ttacataaaa agaatgatgg caatagagtt      1200
     gctggtagca ccatgcgtga aaagtttcca gaggtctctt ctatagccat tgagaatgct      1260
     cgaattggcg agtgggagaa tattcttact gctcataatg aaagcaaggc agccaggact      1320
     tgggatatgc gctctaagag ggttggtaga tggacgtttg aaactatcga tgacggtatg      1380
     gttaaatctg tggccatttc tcaatgtggt aactttggtt ttgtaggctc gtctaacggt      1440
     ggtattggtg tttataatat gcagagtggt atgctcagaa agaagtaccg gttgcataag      1500
     agagcagtaa caggtgtagc tgtggatggg atgaacagaa agatggtttc ctgtggtctt      1560
     gacggtatca taggtttcta tgacttcaat gaatctaaat acttgggcaa gttacaaatg      1620
     gatgctccaa ttacgtcaat ggtttaccac agatcgtcgg atctatgtgc gtttgccttg      1680
     gatgatttat caattgtagt tgtcgacact gttactcaaa aagttgtgag acaattatgg      1740
     ggacatggta acagaataac agcattcgat ttttcaccag atggtcgttg gttggtatct      1800
     gcctctctgg attctactat cagaacctgg gatctgccta ctggatcgtg tatcgatggt      1860
     gttaagattg aatcagttgc aaccaactta aaattctcac caaatggtga tatgttagcc      1920
     actacccatg ttatcggtaa tggtattttt atttggacca atagagcaca attcaagcag      1980
     atttctacca aggctatcga cgaagatgcc tttcaaaaga tcatgttgcc aaatgcctca      2040
     gtttctggta atagtcaatt cttggaagga gcatttcaag atggcggtga tgaccatgaa      2100
     cctcttgata taaacaatta ccaatcggtg gaacaagtta acagtgaact cgtaacgtta      2160
     tcgttgggac caagaaacaa aatgaacacc atcctccatc ttgatgtgat taagaagcgt      2220
     tctaaaccta aggaagctcc aaagaagcct gaaaaggcac cattcttctt acaacttgca      2280
     ggtgataagg tgggtgacga agcttctggt cgtgaaggta ttagttttga aacgccagaa      2340
     gagattagag ccagggagga gaagcaaaag cagtcagaag aagcacaagc tgagttaacc      2400
     aaattcaaac ctggtacgaa ccgtggattc caatccaaat ttacaaagtt gttattacat      2460
     ggcaataaac aaaatcaata tgaagagttc ctagagtact tggttagcat gtctcctgct      2520
     acacttgatt tagaaatcag atcattgaat agctttgagc catttgaaga aataattgcg      2580
     ttcatttctg cacttactgc cggtttgaag actaataaga attatgaact atatgaggcg      2640
     atcatgaact tactattcaa ggcccacggt gatgtgattc atgctaacaa taccaactgc      2700
     gacctgcaag acgcactttc ccagtgggaa actgttcatg gcacagagca aaaaatggat      2760
     gagttggtta agttctgttc aagtgtactt gattttgtct ctagatcata a               2811
//

If you have problems or comments...

PBIL Back to PBIL home page