(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE434

CAGLA1_12.PE434      Location/Qualifiers
FT   CDS_pept        complement(982943..984334)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246749" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440112"
FT                   /locus_tag="CAGL0M09955g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62757.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG190857"
FT                   /db_xref="HOGENOM:HBG396734"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B7188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ15"
FT                   /transl_table=1
FT                   /translation="MEYNSLMMDAHDVGEYEMGDAFKATHLNVKDGGGQRMSYSVSPSS
FT                   RPLMTAGEEVVHHIPTRGPSDAQAARLRRDSIAHSQGIGGVSWGSLSISSWLRDEVMLQ
FT                   HPSSQQSYQNQERKFSINNGLLQIQMNAPIGQGPISASTNTFLPHLEEQYCKDYSCCGI
FT                   SLPGLHDLLRHYEEAHISTSPGTSMSRPVGGSDASMGMSTGTVQTRNLMDRSMGSHGMS
FT                   PPTPMSSQSKIGSNTSINMHQISGANNNNNIKSKYMVNRGHNSNNIVDTVSTNEVFLNN
FT                   GRGTTSMETSRGTQPIHKHAHPQALQNMMMPPNNGSTQGLHSSNVDIAIDDDDDDEDDD
FT                   DDDEDDEEEEEQDKKEFYIDDPARRLYVMDHEEYKPFKCPVIGCDKTYKNQNGLKYHRL
FT                   HGHQNQTLRENADGTFSVIDPESNEVSTLDAMGNDKDKPYRCEVCGKRYKNLNGLKYHR
FT                   GHSTH"
     atggagtaca actcgctgat gatggatgcg cacgatgttg gcgagtatga gatgggtgat        60
     gcttttaaag ccacccatct gaatgtgaaa gacggcggtg gacaaaggat gagctacagt       120
     gtcagtccga gcagtcggcc tctgatgaca gctggtgagg aagtagtaca ccacataccc       180
     acgcgggggc cgagtgatgc acaggcggcg aggcttcgga gagattctat agcccactcg       240
     caaggtattg gtggtgtatc ctggggttca ctgtctatca gctcctggct tagagatgag       300
     gtgatgttac aacatccgtc ctcacagcag tcatatcaga accaggaacg caagttttcc       360
     attaataatg gtctactgca gatacaaatg aatgcgccta taggtcaagg gcctatatcg       420
     gcgtcgacaa acactttttt gcctcaccta gaagagcagt attgcaagga ctactcttgt       480
     tgtggcattt cattgccagg attgcatgac ctactgaggc attatgaaga agcgcatata       540
     tcaacttcac cagggacttc aatgtcaagg ccggttggtg gtagcgatgc atctatgggc       600
     atgagtacag gaaccgttca aacaagaaat cttatggata gatccatggg ttctcatggg       660
     atgtctccgc ctacaccaat gtcttcacag agtaagattg gctccaatac atcgataaat       720
     atgcaccaaa taagtggcgc taacaataat aataatatta aaagcaaata catggtaaac       780
     agaggtcata atagtaataa tatagtggat actgtgtcca ccaatgaagt gttcctcaat       840
     aatggcaggg gcactacctc tatggagacc tctagaggaa cacaaccgat acataaacat       900
     gctcaccctc aagcattgca aaatatgatg atgccaccaa ataatggatc aacacaaggt       960
     ttacattcgt ccaatgtcga catagccatc gatgacgatg atgatgacga agacgatgat      1020
     gatgatgacg aagatgatga ggaggaggaa gagcaggata aaaaggagtt ctacattgat      1080
     gatccagcaa gaagattgta tgttatggat catgaggagt ataaaccttt caagtgtcct      1140
     gtgattggct gtgataaaac atataagaac cagaacgggc ttaaatatca taggctgcat      1200
     ggccatcaaa accagactct gcgagagaat gccgacggta ctttcagtgt catagatcca      1260
     gagtccaacg aagtatccac attggatgcc atgggaaacg ataaggataa gccataccgc      1320
     tgtgaggttt gtggtaagcg ttataaaaac ctgaatggac tcaaatacca tagaggccac      1380
     tccacacatt ga                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page