(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE436

CAGLA1_12.PE436      Location/Qualifiers
FT   CDS_pept        987540..996914
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113101" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349528"
FT                   /locus_tag="CAGL0M09999g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="GTPase activator activity"
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62759.1"
FT                   /db_xref="GO:0005096"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="HOGENOM:HBG059043"
FT                   /db_xref="HOGENOM:HBG204174"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR023152"
FT                   /db_xref="UniParc:UPI00003B718A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ13"
FT                   /transl_table=1
FT                   /translation="MSHFGKSGHRRFSSSGNKPDSRHVSAHHRVPPPRPPRPTTPITNA
FT                   TPNVLSPESGQSSAGSRGSHRQSLSNPIGKSKMTETLVYHLFFDRILPVLPVESTLTTY
FT                   REVESDQFFISCRGVIMNVALSRDLNPVIDYSLQLIESLTESRELISDEINEDVAQSVL
FT                   VLLRLLSDTLEFCWESKESPEDKVKDEPSFENIPIDDNKEYVNMGEQARAGNMFTGSTI
FT                   GYSTHKPGFHRVPPPQIDSTLATRLLSVCTRLKYNTRTLRVLKNMSKNLYGNGTITYSS
FT                   VLPKFQAWLKYHNYPKYTETVDLTIDYILRFIAAANPADYDKYVDSKVTNPLLISHTLT
FT                   ELGIVKYLDFFGCVFLTPENVGPFLETLRHLSGFMKRTIFHSLLLYYSSKAFLFWILSR
FT                   PNEYVQLYYALQNLDSSKSNTFHQGNSNSSIATIPYCVSVLFDDIYSTFNVSSLLTNIY
FT                   DTRGHNGSTTQPVETEQSQATSPGSTNPVLFSPTLTSNDGIITSPTMGSNQIASPLSPL
FT                   PMSLDFNSRTQAQGFPLEETASIHSSKRSYNIDESVYSTMGSTHSNINTPTTNASFTHP
FT                   NEDEIPTSGSGHLQYVLELFSNYEETELSSHTSILRFLLSLILLDTDVFTDINAMTFRY
FT                   IPDTSKIIQQYSQKQGTRDAGAGTHMQNDDPSKEKEKNQSIKQITHGLKKLTNLSSSKK
FT                   KTVKFITMLIRNLNGAQMVSDVSLVDSLKTLVALVTLTSSISLIDSNLPSVLFAKRIFS
FT                   ILGHNLDVGKNWESKTNGFIASCTERNPISHRRLQLEFFAAAIQLDSDKLLSHIHLERE
FT                   LAGLNLRRLLLYTEGFKVFFNLLSSDVLRKKVALSSSNFLKSLFCIIADILLKAFPYFD
FT                   AKVTSIVSSILDGSILEKYDTIKTLAGLEPSNPPVLDRTDSSVKLKLQKKITNWDVHEV
FT                   LPTLSAVSSSSDINLSDTGKSIAESTERRSNTSTPAHTSTPANLTHNPLSTIASPPSTP
FT                   GSIGNYRNNPGMNVLSPHARRLQNVKIDSPQVEGERTRQSPYYFGATSTGEYSNQSVSH
FT                   SSLPKTTRSSGSQEKSRRSSDDKNKPQLKMQDSDDVIVLKTNENDDARRIMINIFSIFK
FT                   KMTNYFILPHDQNLNTIWVSKDFRNIMKPIFVAIIDTDTRLQTTAQSFMDVLIRYISKF
FT                   SSDITARSLNEHYLLCNYTITLFAASLFDLKLDNKKREIILRIVVKFLNVKSDLSRIAA
FT                   QKDLQYALYSTELVTFPLLTATVGGGLFISLYCNKGEIPRLLKKGFGEFLFAINCYEKH
FT                   VGEIDRTCIYNLGFIVAMSRDNYAASGSVAFQRRLRNKILHHIKRPDTILLDAMDVIYR
FT                   KWSSYMRKENITQEELIDFRSLAGILASMSGILLSFGETSTDNVPHLFEFRGDLIKKMD
FT                   YFVFKQCQWLNNPDLLTRENSRDILSMELHPLSFNILFDNLRIKIEELRSVNLSQKVHE
FT                   SSFVLLEQIITIVRTVLNRDDDERIMLLFSIRVVSTIDQLSDLVEKIPHSSVKYYKAII
FT                   QMAKLFRAIQHSEISLGIKNHFYLKNKWLKLLTNWFKVTISIDYDFDNLSKPLREMDLK
FT                   KRDLDFLYIDTAIETSKAVAYLTENVPLDIPPSASKDELERASTIVFGNYFTIFLKGLE
FT                   KSTDIQRFPVSLKHKITILNENVILSLTNLSNANVDASLQFTLPMGYSKDKNIRIAFLK
FT                   VFINIVTNYPKLKVESERKKLYAVDQLVQYLIEHPHLAFQAGIICPASDVDAFVAGLVN
FT                   GFDSRNASHILVTQLIKDEIDRASRYADVLRRNSCATRALSLYARSKGQSYLVRTLKPV
FT                   LDEFFESRDSFEIEKILPDDPEAEKNVDMFIHYMSKLINAITESVDYFPPELINICQTI
FT                   FHSVKEKFPDYSFIAVGSFVFLRFLGPAIVSPDAENIILISQTRDKRPLITLAKVLQNM
FT                   ANGSENLTRWPILNKKLDIFKDFSNRIFEFLSKICTIDSKPNIEIRRDPEPYYFEFNFL
FT                   HKFLYEHELEIRKMIVESLVSLDDFDYVRKTFLFVDDIMGVLGRPKVELKNEIPPYIVE
FT                   HMEENPHLYEFMNRNAFKNVSLGDEYEPFMHESMSLDGLPIITITFRKFEAENIEVDAI
FT                   VYRTIQVYSKMWMTKHYLVLDCTGSDSIDMNYNKLTSLFFSLLPDIAIENCIGAIYFNV
FT                   SENFMNQWVNVLRGDNPYLVAQVPHHFINSSSDQEQVKTLGLTGKGADVVQDTRVSLHD
FT                   ISLYHEDTKNLENVSLKIGNRYIQILHEATKQYKLHALNQILNIPFNDVYEIVDLATVG
FT                   VSSITGLPNEFTINFINGKRLVLVSKKYLEIVKMFNYAQLKIEDEYGTESQNRELTSTH
FT                   EESYVKESQEIICHLSLVILNGLFNDDNEVKNISYNLLVVTQNAFNLNFGSRFQKAPEV
FT                   YVPDNTTTFLSTIARALAESSPELTLHMWTYFLEGLENDVIPHEHIPTIICCLSYWVPN
FT                   LYRYVYLVDEEEGANNLSKIIRSLIQLTVKDPDFTTVYLQQIWFLLVLDDRLTSVTVEE
FT                   FVTHALDRDSESRDWKKAVSLLTAFPTVEVACQVIGKLMDIIKSFLPSLKMEVSTHSWS
FT                   ELEILVRISVSLFFESPLLTQMCLPEVLFIISLLIDIGPTHIRYCLHELLMNICHSLMI
FT                   NSSLPKENSERLDGICAVFARQKLNFMSGFSQEKGRILPNFSASSFSSKFGTLDHFVTN
FT                   VFKLMEYGSTSEAAQWKTKYKKYLLGCVFNHESFLSARAIMILGIIGKIDTNEILCRDL
FT                   LAETMKIFAEPVVTDEQLFVGISHIFTYSKIVAGLDPAGQMLPRMFWLATVFVESPHPI
FT                   LFEGGLQFLINCLKHLYEYHYKINNTEKLISELLIESRSFASELLEELEGYTDCLWTKD
FT                   NFEHLILGFITRGLSLAVLRGVALDCLMTAFKYSFREHQMIPRTSHHLNYLFLLYLVSN
FT                   QETFLNLLDSVGFESDYIELDDNIKIPRALVEWISSDNECSNITLYQGALLFASPASDE
FT                   PSKLRFELLTRYLLGISPKCVFRYYFVTRQELRRISSLEQQSDSSTIAFEIAGMLVMHD
FT                   DFDILDIYNKDSVQLLKSRGLFSLTKVNIFGRSFEDIMNSLQENSDQIYNRKRLTTLII
FT                   SKIIYQSQLTL"
     atgtcacatt ttggtaaaag tggacatagg aggttcagca gtagtgggaa caaaccagat        60
     tcgaggcatg tatcagctca tcatagagta ccaccaccaa ggcctccccg cccgactact       120
     ccaattacga atgcaacccc gaacgtccta tcaccggaat caggtcaatc aagcgcaggt       180
     tcgaggggtt cgcacaggca aagcctcagc aatccaatag gtaaatctaa aatgactgaa       240
     acattggtct accacctatt ttttgatcga atattaccag tgctaccggt tgaatctaca       300
     ttaacgactt atagagaagt agagagcgat cagtttttca tttcatgcag gggcgtgatt       360
     atgaatgtag ccttatccag agatttgaat cctgtcatcg attattcatt acaactcata       420
     gaatctctga ccgaaagtag agaactaata tcggatgaaa ttaatgagga tgttgcgcag       480
     tctgtattgg tcctccttag acttttaagt gatacgttgg aattttgctg ggaatctaag       540
     gaaagtccag aagataaagt taaagatgag ccaagttttg agaatatacc aatagatgat       600
     aacaaagagt atgtgaatat gggggaacag gcgagagctg gtaatatgtt tacaggatct       660
     actatcggtt actcgacaca taaaccaggc tttcacagag ttccacctcc acaaattgat       720
     tctaccttgg ctacaagatt gctaagtgta tgtacgaggt taaaatataa cacaagaaca       780
     ctaagagtat taaaaaacat gtccaaaaat ttgtatggca atggtacaat aacttattcc       840
     agcgtcttac caaaattcca agcttggttg aaataccata actaccctaa atatacagaa       900
     actgttgatt taacaattga ctacattcta agattcatag ctgctgcaaa tccagcagat       960
     tatgataaat atgtagactc taaagtgacg aatccacttt tgatatcaca tacattaacg      1020
     gagctaggca tagtaaagta ccttgatttc tttggatgtg tatttttaac gccagaaaat      1080
     gtgggcccat ttttggagac actgcgacat ctatcaggat ttatgaaacg aacaattttt      1140
     cactcgttac tgttgtatta ttcttctaag gcatttttat tttggatttt atcaagacct      1200
     aatgaatatg tccaactata ttacgcctta caaaatctgg acagctccaa atcgaatacc      1260
     ttccaccaag ggaacagcaa tagttccata gcgacgattc cttactgtgt ttcagtatta      1320
     ttcgatgata tttattctac attcaatgtc tcatcattat tgactaatat atacgacacg      1380
     aggggccata acggatcaac aacacagcca gttgaaacag aacaaagcca agccacatct      1440
     ccaggaagta caaatccggt attattttcc cctacactga ctagtaacga cggcattata      1500
     acatccccta caatgggtag taatcaaatc gcgtcccctt tatcaccact cccaatgtca      1560
     ctagatttta attctaggac acaagcgcaa ggatttccat tagaagaaac agcctctata      1620
     cattctagta aaaggtcata caacatcgac gaatccgttt acagtactat gggttcgaca      1680
     cattcaaata ttaatactcc gacaacaaat gctagtttca cacatcccaa cgaggatgaa      1740
     ataccgacgt ctggttcagg acatttacag tatgtgttgg agctattctc aaactatgaa      1800
     gaaacagaac tatcttccca tacttctatt ctaaggtttt tactttcact aatactgttg      1860
     gatacggatg tctttactga tattaatgcc atgactttca ggtatattcc tgatacttcg      1920
     aaaattatac aacaatactc acaaaaacaa ggaactagag atgcaggtgc tggtacacat      1980
     atgcaaaatg atgatccttc aaaagaaaaa gaaaaaaatc agagtataaa acagattact      2040
     catggcttaa agaaattaac taacctatcc tcatccaaaa agaagacagt aaagtttata      2100
     acaatgctga taaggaattt aaatggtgca caaatggttt ctgatgtctc actagtagat      2160
     tcgcttaaaa cattagttgc tttggttaca ttaacctcct ctatttcgtt aattgattca      2220
     aatctgcctt cggttttgtt tgccaagaga atattttcta tccttggaca taatctagat      2280
     gtagggaaaa attgggagtc taagacgaat ggctttattg catcttgtac tgaaagaaat      2340
     ccaattagcc ataggagact tcaactagaa ttttttgcag cagcaataca actagattct      2400
     gataagcttc tttctcatat tcacctggaa agggaactgg ccggtttaaa tctaaggaga      2460
     ctccttctat atactgaagg ttttaaagtg ttttttaatt tactaagttc tgatgtttta      2520
     cggaagaaag tagcactatc aagtagcaat tttttaaaat ccttgttttg cattattgca      2580
     gacattttac tgaaagcttt cccatacttt gatgcaaagg taacatctat tgtttcatca      2640
     attttagatg gctccatttt agagaaatat gataccataa agacgctagc aggtttagaa      2700
     ccttctaatc cacctgttct agataggact gattcaagcg ttaagttgaa acttcagaag      2760
     aaaatcacaa attgggatgt gcacgaagtt ttacctacct tgtctgctgt atcatcatca      2820
     tctgatataa atctttctga tactggtaag agcattgcag aatctacaga acggagatca      2880
     aacacctcaa cgcctgccca cacctcaacg cccgcaaatc taactcataa tccgttatct      2940
     acaattgctt caccaccctc gacaccaggt tcaattggta attacaggaa taatccagga      3000
     atgaacgtat taagtccaca tgcacgtagg cttcaaaatg taaagattga ttctccacaa      3060
     gtagagggtg aaagaactcg acaaagcccg tattattttg gagcaactag tacaggtgaa      3120
     tattcaaacc aatccgtttc acattcatcg ttaccaaaaa ccactcgatc ttcaggaagt      3180
     caagagaaat ccaggagatc atcggatgat aaaaataaac cacaactaaa aatgcaagac      3240
     tctgatgatg taattgtatt gaaaacgaat gagaatgatg acgcccgcag gattatgatt      3300
     aatattttca gcatttttaa aaaaatgact aattacttta tcctccctca tgatcagaat      3360
     ctaaacacta tttgggtttc taaagatttc agaaacatca tgaaaccaat ctttgttgcc      3420
     ataattgaca cagatactag actacaaact acagcacaat catttatgga tgtactaata      3480
     agatacatat cgaaattctc aagtgatatc actgccagaa gcttgaacga gcactacttg      3540
     ttatgcaact acacaattac attatttgcc gcttcacttt ttgatctaaa acttgataat      3600
     aaaaagagag agataatttt aaggattgta gtaaagtttt tgaacgtgaa atctgattta      3660
     tcaagaatag cggctcaaaa agatcttcaa tatgcacttt attctactga gcttgtaaca      3720
     ttcccgttgt tgacagctac tgttggagga gggctattta tctccttata ctgcaataaa      3780
     ggagaaattc caagattatt aaaaaagggt tttggggagt ttttgtttgc tatcaactgc      3840
     tatgagaaac atgtcgggga aattgatagg acttgtatat acaaccttgg atttattgtt      3900
     gctatgtcaa gggataatta tgccgcatct ggatcggtcg catttcagag acgtttaaga      3960
     aataaaatct tacatcacat caaaagacca gacactattc ttcttgatgc catggatgtt      4020
     atttaccgaa agtggtctag ttatatgagg aaagaaaaca taactcagga agaactaata      4080
     gattttagaa gcttggctgg tatactggcc agtatgtcag gtatattgct ttcttttgga      4140
     gaaacaagca cagataacgt ccctcattta tttgaattca gaggggacct tatcaaaaaa      4200
     atggattact ttgtttttaa gcaatgccag tggctgaata atcctgattt gcttacccga      4260
     gagaactcta gagatattct aagcatggaa ctacatccct tatcatttaa tattctgttt      4320
     gataacctaa gaattaagat tgaggaatta agatccgtaa atctttcaca aaaagttcat      4380
     gaatcttcat ttgttttact agagcaaatc ataactattg tcagaactgt cctgaatagg      4440
     gatgatgatg aacgcatcat gcttttgttt tctattagag ttgtatcaac cattgatcaa      4500
     ttgagtgatc tagttgaaaa aatacctcat agctctgtga aatactataa agccattatt      4560
     cagatggcta aattatttag agcaatccag cattctgaaa ttagtctagg gataaagaac      4620
     cacttttacc tgaagaataa atggttgaaa ttacttacaa actggtttaa ggttactatt      4680
     tctattgatt acgattttga taatctgtcc aaacctctaa gggaaatgga tttaaagaaa      4740
     agagatctcg acttcctgta cattgatact gctatcgaaa catctaaagc tgttgcgtac      4800
     ttaaccgaaa atgtgccact ggatattcca ccttctgcct ccaaggacga acttgagaga      4860
     gcaagtacaa tagtgtttgg taactacttt accatattct taaagggtct agagaagagt      4920
     accgatattc agagattccc agtatccctc aaacacaaaa taactatctt aaatgaaaat      4980
     gtcattttat cattgacgaa cctttcaaat gctaacgtag atgctagttt gcaattcaca      5040
     ttaccgatgg gttactctaa agacaagaac ataagaattg catttttgaa agttttcatt      5100
     aacattgtga caaactaccc gaaattaaaa gttgaatcag agcggaagaa gctttatgca      5160
     gtagatcaac tggttcaata cctcattgaa catccacatt tggctttcca agcaggtata      5220
     atatgtcctg ccagtgatgt agatgctttt gtcgctggac tggtcaatgg ttttgattct      5280
     agaaatgctt cacacatatt ggtgacacaa ttgattaaag atgaaataga tagggcgtcg      5340
     agatatgccg atgtcttgag aagaaatagc tgtgcaacta gggcactttc tttgtatgcc      5400
     agatctaagg gacaaagcta tctggtgaga accttgaaac ctgttttgga tgaatttttc      5460
     gaaagtcgtg atagctttga gatagaaaag atactacccg atgatccaga ggcagaaaag      5520
     aacgtcgaca tgtttataca ctacatgagc aagttgatta atgctataac agaatctgtg      5580
     gattactttc caccagaatt aattaatatc tgccaaacta tctttcattc ggtaaaggaa      5640
     aaattccctg attattcatt cattgctgtt gggtccttcg tatttttgag atttttaggc      5700
     cctgctatag tcagtcctga tgccgagaat attattctga tttcccaaac aagagataag      5760
     aggcctttaa taacacttgc taaggtccta caaaatatgg ctaatggctc tgaaaaccta      5820
     actagatggc ctatattgaa caaaaagtta gacattttta aggactttag caaccgcata      5880
     tttgaattct tatcaaaaat ttgtactatt gactccaaac cgaatataga aattagaaga      5940
     gaccctgagc cgtattattt tgaatttaat ttcttacaca agtttttata tgaacacgag      6000
     ttggaaatta gaaaaatgat tgtggagagc ttagtctctt tagatgactt tgattatgtt      6060
     cgtaaaacat tcctatttgt tgatgatatt atgggtgttc taggtagacc aaaagttgaa      6120
     ttaaagaatg agatacctcc ttatatagtg gagcatatgg aagaaaatcc acatttatac      6180
     gagtttatga ataggaacgc gttcaagaat gtatcattag gtgatgaata tgagccattt      6240
     atgcatgagt ctatgtcatt ggatggtttg ccaataatca ctattacatt tcgtaagttt      6300
     gaagcagaga atattgaggt cgacgccatc gtttacagga ctatacaggt ttattccaaa      6360
     atgtggatga caaagcatta tctggtgcta gattgtaccg gcagtgattc tatagacatg      6420
     aactacaata aattaacgtc tttgttcttc agtctattac ctgatatagc tattgaaaac      6480
     tgtattggtg ctatctattt caatgttagc gagaatttca tgaatcaatg ggttaatgtt      6540
     ttgagaggtg ataatcccta tctcgttgca caagttcctc atcatttcat caatagcagt      6600
     tctgaccaag aacaagtaaa aacactaggc ctgacgggaa aaggcgctga tgtggtacaa      6660
     gatacaagag tctccctgca tgatatatct ttataccatg aagatactaa aaatctagag      6720
     aatgtttcat tgaaaattgg taataggtat atccaaattc tacatgaagc aaccaaacaa      6780
     tataaactgc acgcactaaa ccaaattttg aatattcctt ttaatgatgt ctatgaaatt      6840
     gtggatttag cgacagttgg tgtttcttca attactggtc taccaaacga attcacaata      6900
     aattttataa acggtaagag actggtttta gttagtaaaa aatatcttga aattgttaaa      6960
     atgttcaact atgcacaact taaaatcgaa gatgagtatg gtactgagag tcaaaaccgt      7020
     gaattgacta gcactcatga agaatcgtat gttaaagaga gtcaagaaat tatttgccac      7080
     ctgtctttag tcatcttgaa tgggttgttt aacgacgata atgaggttaa gaatatatct      7140
     tacaatttac tagttgtaac acagaatgct ttcaacctaa actttggaag cagatttcaa      7200
     aaagcacctg aagtgtatgt tccagataat actaccacct tcttgtccac tattgctaga      7260
     gctctagcag aatcttcacc tgaactgacg ctacacatgt ggacttactt cctagaaggc      7320
     ttggaaaatg atgttatacc tcatgaacat atacctacaa taatttgctg tctatcatac      7380
     tgggtgccta acctctatag atatgtctat ttggttgatg aagaagaagg tgcaaacaat      7440
     ttatcaaaaa taataagatc cttaatccag ctgactgtaa aagaccctga ttttactaca      7500
     gtttatttac agcaaatctg gtttttgctt gtattggatg accgtttaac atcggtaaca      7560
     gtagaagaat ttgtcactca tgctttagac agagattctg aaagtagaga ttggaaaaag      7620
     gctgtatccc tattgacagc tttcccaact gttgaagtcg cgtgccaagt tattgggaag      7680
     ctaatggata taataaagtc ctttttacca tcattaaaaa tggaggtgtc tactcacagt      7740
     tggtctgagc tagaaattct tgtaaggatt agtgtttccc tattttttga atcaccttta      7800
     ttaacgcaaa tgtgtcttcc tgaagtacta ttcataatat cacttttaat tgatattggt      7860
     cccacgcaca tcagatactg tctacatgaa ctattaatga atatttgcca ttctctgatg      7920
     attaattcat ctttaccaaa agaaaactct gagaggctcg atggcatatg tgctgttttt      7980
     gcaagacaaa agctaaattt catgtctggt tttagtcagg agaagggccg tatacttcca      8040
     aatttcagtg cttcttcatt ctcgagcaaa tttggaaccc ttgaccattt tgttacgaat      8100
     gttttcaaac ttatggaata tggatctaca tctgaagctg cgcagtggaa aactaaatat      8160
     aagaagtatt tgttgggttg tgtattcaac cacgagtctt ttctgtcagc tagagctatc      8220
     atgattctcg gtattattgg gaagatagat accaatgaaa ttttgtgcag agatctttta      8280
     gccgaaacaa tgaaaatctt tgctgaacca gttgtcactg atgaacagct atttgttggt      8340
     atttcacaca tctttaccta cagtaaaatt gtcgctggtc tagatcctgc tggtcaaatg      8400
     ctgccaagaa tgttttggtt agcaacagtt tttgttgaat cacctcatcc gattttgttt      8460
     gaaggaggat tgcaattctt gataaattgc ctcaaacatt tatacgagta tcactataaa      8520
     atcaataata cagagaagct aatttctgaa cttttaatag agtcgaggag ctttgcatca      8580
     gaattactag aagaactaga aggctatact gattgcttgt ggacaaaaga taattttgaa      8640
     catttaattc ttggttttat aaccagggga ttatctttag ctgtcttaag aggtgtcgct      8700
     ctcgattgcc tgatgacagc ttttaaatat tccttcagag aacatcaaat gatccctagg      8760
     actagtcacc acttaaacta tctgtttctg ctatatttgg tctccaacca ggaaaccttt      8820
     ctaaatctct tggacagcgt aggcttcgag agtgattata ttgaactaga tgacaatatt      8880
     aagataccca gagctctagt ggaatggatc agttcagata atgaatgttc aaacataaca      8940
     ttgtatcaag gtgctctttt atttgctagt cctgcttcag atgagccaag taagttgaga      9000
     ttcgagctgc tgacaaggta tcttctaggt atcagcccca aatgtgtttt ccgttattat      9060
     tttgttacta gacaagagct aagaagaatt tcatcacttg agcaacaatc tgactctagt      9120
     accattgctt ttgaaatagc tggtatgctg gtaatgcatg atgatttcga tattttggat      9180
     atatacaaca aagattcagt acagcttctg aaatcaagag gtttattctc tttgactaag      9240
     gtgaacatat ttggtcgtag cttcgaggat atcatgaact cgttacagga aaattctgac      9300
     caaatttaca accgtaagag attgacaacc ctaattatct ctaaaatcat ttaccaatcc      9360
     caattaactt tataa                                                       9375
//

If you have problems or comments...

PBIL Back to PBIL home page