(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE437

CAGLA1_12.PE437      Location/Qualifiers
FT   CDS_pept        997486..998997
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141996" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440114"
FT                   /locus_tag="CAGL0M10021g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62760.1"
FT                   /db_xref="HOGENOM:HBG252654"
FT                   /db_xref="UniParc:UPI00003B718B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ12"
FT                   /transl_table=1
FT                   /translation="MDDQTRLRVFEPLDCNSFVSATPNSTHLSKLSVQTPTTSSFIRNP
FT                   YERDQTALENQSGSELLRWKYDQREFMFNSNSTPSKNSNSQTEKYEFPITEKLVKNKNP
FT                   GCKRRTNQLIGAKPSRPSGLQNVTSKLELLDETHFTSLPIPAPKGTKIDNSAILSDIID
FT                   DNSDDIITADDSVILPSKRSFRTPANEIKVHNNGNKRYISYKYSNRYPERESSPSEQMI
FT                   SSGKDTHPIVIVEDYLLSDSERSFTESTRKRKRYNSNNDGLKPKLSLHNLKTKIRSSNT
FT                   DHLPVKKKVHYLKECSTVDSSTNEENEAGSSKCIKEVLNEFLPPKSNSADCDLYISNLL
FT                   SKGTNELKRCVICEKILYEVSSLLYKENDFKELVCGSCTEKYETIAKLLEGCELESTFE
FT                   YSLDSSSFEANTLDSSLIQSSHTVCREVTPPHNSSLQHMRRDSFSEDLIKALQSQLIKN
FT                   SKQIPENSIFPNKALSWFIDARRKLRWRWRVSGLLPEFTINNNNE"
     atggatgacc agactagatt aagagtgttt gaacccctcg attgtaactc ctttgtcagt        60
     gcgactccca attccacgca tttgagtaaa ctatcagttc aaacaccgac aacatcttca       120
     tttatcagga atccgtatga acgggaccag acagcattag aaaatcagag tggatcagaa       180
     ttattaaggt ggaaatatga tcaacgagaa tttatgttta atagtaatag tacaccatca       240
     aaaaactcta actctcaaac agaaaaatat gaattcccaa tcacagaaaa attggtaaaa       300
     aacaaaaatc caggatgtaa gagaagaaca aaccaactta taggagccaa accaagccgg       360
     ccatcaggat tgcaaaacgt tacatctaag ttagaactgt tagatgaaac ccatttcacg       420
     agcttaccga tccctgctcc aaaaggtact aaaattgaca atagcgctat ccttagtgac       480
     ataattgatg ataattctga cgatataata acagccgatg actccgttat tctgcctagc       540
     aagaggtcgt tcaggacacc agccaatgag attaaggtgc acaataatgg caacaaaaga       600
     tacataagct ataaatatag taacagatat cccgaacgag aatccagtcc atctgagcaa       660
     atgatatcat caggaaagga cacacatcct attgttattg tagaagacta cctcctatca       720
     gacagtgaaa gatcatttac cgaaagtacg cggaagagga agagatacaa ttcaaataat       780
     gacggattaa agccaaaatt gtcattacac aatttaaaaa ccaaaataag aagctcgaat       840
     accgatcatt tacctgtaaa aaaaaaagta cactacctga aagaatgctc tacagtcgat       900
     agctctacga atgaagaaaa tgaggcagga tcctcaaaat gcataaaaga agttctaaat       960
     gaattcctac cacccaaatc taattccgca gattgtgacc tatacatatc caatcttctc      1020
     tcaaaaggca ctaatgaact gaaaagatgt gtcatctgcg agaaaatatt atatgaagtg      1080
     agttccttat tatacaaaga gaatgacttt aaagaattgg tctgtggaag ctgtaccgag      1140
     aagtatgaaa caattgcaaa actgttggaa ggctgtgaac tcgaaagtac ttttgagtat      1200
     tctttagatt cgtcatcatt tgaagcaaat acgcttgact catcacttat acaatccagt      1260
     catactgttt gtcgagaagt cactccacca cataactcga gcctccaaca tatgaggaga      1320
     gactctttct ctgaggatct gataaaagct ctgcaatcgc aactaattaa aaatagtaaa      1380
     cagataccag agaatagtat ttttcccaac aaagctctta gctggttcat tgatgctaga      1440
     aggaaactac gctggagatg gagggtaagt gggttgctac cagaattcac tattaataat      1500
     aacaatgaat aa                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page