(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE442

CAGLA1_12.PE442      Location/Qualifiers
FT   CDS_pept        1008833..1010461
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001083" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440116"
FT                   /locus_tag="CAGL0M10131g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="DNA binding"
FT                   /protein_id="CAG62765.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG058165"
FT                   /db_xref="HOGENOM:HBG202317"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI00003B7190"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ07"
FT                   /transl_table=1
FT                   /translation="MDYMNLGLRSRKTGIDVKKNLAKDEYSMENIDDFFKDDDTSFLSR
FT                   RKSRKSSLLPEADIQNRILPSPLTKQHNVRDTDGFKVPQNINVSHRSTIERAPTEFQHS
FT                   VISEDIPEVIPYEGQSATPDRNIEPIDEDELANMPKPRYRSQYNLGAGNDDTDLINLTP
FT                   EKDGRGTYNDVPDLIDDEGDTSKDNTTFNTSDHAMLEDEVEDGFVLESEEDRDYMESDE
FT                   GSLADDTDDASDSGDDIGTQFAAEINRPGNESPLSSDDEDYISENSTGHNRLEDEIDNP
FT                   SLPTRLSKPYDIVDGVRRSKRVKIPPLEYWRNEKIQYKRRRNEPVLDIDKVITYNHSES
FT                   EEESEEEQKKVKKQRKPVTRTRPYNYVPNGRPRGRPRKNISDDPNGNLIRKIENGEEPK
FT                   GEWLKHGMLEATVKNLHGEAKTELVAMAPNVSQSEETKASGEDDYSIEILFDKYNEAFA
FT                   SGMLKVPVDGRKSPADSNTAFITFHVLDGIVEVTLDGKNFICTKGSSFQIPAYNEYAFA
FT                   NIGSNEVRMFFVQVSPPSDFYSEHY"
     atggattaca tgaacctagg gcttcgatcc cgtaagacag gcatagatgt gaagaaaaat        60
     ctggcaaaag atgagtatag tatggagaac attgatgatt tcttcaagga tgacgataca       120
     agctttctat cacgaagaaa gagcaggaag tcctccttat tacctgaagc tgatattcag       180
     aaccgtatct tgccaagtcc acttactaaa cagcacaatg tcagagatac agatggcttc       240
     aaagttccgc agaacattaa tgtttcacat aggtcaacaa ttgaaagagc accaactgag       300
     tttcaacatt cagtaataag tgaggatata ccagaagtga taccatatga aggacagtca       360
     gctacaccgg accgaaatat tgagcctata gatgaggatg aactggctaa tatgccgaaa       420
     ccaaggtata gaagtcagta caatttagga gctgggaacg acgatacaga tctgataaat       480
     ctgactcctg agaaagatgg aagaggcact tataatgacg tgccggattt gattgatgac       540
     gagggagaca cttccaaaga taacacaaca ttcaatactt cagaccatgc aatgttagaa       600
     gatgaagttg aggacggctt tgtacttgaa tctgaagaag accgagatta tatggaaagt       660
     gatgaaggct ccctggctga tgataccgat gatgctagtg attctggtga tgatatagga       720
     acacaatttg cggctgaaat aaatagacct gggaatgaat caccgctttc aagtgacgat       780
     gaggattata tttccgaaaa ctccacaggt cacaacaggt tggaggatga aatagataac       840
     ccttcccttc ctacaaggtt gtcaaaacca tatgatattg ttgacggtgt gaggcgatca       900
     aagagagtga aaattccgcc tttagaatat tggcgtaatg aaaaaattca atataaaaga       960
     agacgcaacg agcccgtttt ggatattgat aaagtaataa cttataacca tagcgaatct      1020
     gaagaagaat ctgaagagga gcagaagaag gtcaaaaagc aaagaaagcc tgttaccaga      1080
     acgcgtcctt ataattatgt ccctaatggt agaccaagag gcaggccgcg gaaaaatatc      1140
     tcagatgatc caaatggaaa tttaatcaga aaaatcgaaa atggagaaga acctaagggt      1200
     gagtggttga agcatggaat gttagaagca actgttaaaa atctgcatgg cgaagccaaa      1260
     actgagttgg ttgcgatggc tcctaatgtc tctcaatctg aagaaacgaa agcatctggt      1320
     gaagacgact attcaattga gatattgttt gataaataca acgaagcatt tgccagtggg      1380
     atgttgaaag taccagtaga tggtcgtaaa agtcctgctg attcaaatac tgcattcatt      1440
     acctttcatg ttcttgatgg tatagtagag gtcacattgg atggaaaaaa tttcatctgt      1500
     acaaaaggat cgtcatttca aatacctgcg tataatgaat atgcatttgc aaatattgga      1560
     agtaatgaag ttcgtatgtt ctttgttcaa gtatcccctc cttctgactt ttattctgaa      1620
     cattattga                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page