(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE443

CAGLA1_12.PE443      Location/Qualifiers
FT   CDS_pept        complement(1010688..1013291)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440117"
FT                   /locus_tag="CAGL0M10153g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG62766.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG203842"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015750"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B7191"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ06"
FT                   /transl_table=1
FT                   /translation="MSAELKSHKLDRSIGSNKAGHEHPISRNYVNNVHNANKHKLSDYP
FT                   MMLTITHIGTSRLSSSSSSSSSSSSNSSSSSSYSRGFISDNLSEYRSMDPKSPNRPVRY
FT                   RSIHSKYTSIREDTQHELVTDKEEIQNNKEVSINILSKPNKHTSIDYHNQGVDTTYQIN
FT                   SGQISRHKQMSKSLPNTPKPLQYQKSLSLSHSPRKLSLKSPSRNFSFKSNSKLNVGTKH
FT                   DQEKKRPVKMKEVFSLFVNSIKVSNNSNNSNDRSDQEVPPKHDLKKVKSISKPYNPKHV
FT                   HHVGFDPVTGDYIGLPEKWQALLESNGITKKEQEKDIKTLLNVVQFYQDVSASKTTDKL
FT                   LQTFPLEKGTICVDDTQVSTPSNITSSADDDAAKPSFNESLMPAISIESRHKNEVNQLI
FT                   LKESFSTEDKFIPSRPAPKPPALQELKAIPPKSPNRPKATRVKNNSSKITSVNSLPNNG
FT                   EPTVQFSNDQKSHKSQRVGTSTDTFRFEKSLSGNKKTISITSTSTSTSKHPTNYRESWG
FT                   IKGHTDKKENSNVIKRDEGNKKAEKDKRMQVVLSRLSKICTPGTPEDKFETYLKIGQGA
FT                   SGGVYLSHSRSDKSQCVAIKQMNLEKQPKKELIVNEIMVMSSSKHQNIVNYIDSYLSGL
FT                   DLWVVMEYMEGGCLTDVVTYCVLTEGQIGAVCREVLQGLEFLHSKGVLHRDIKSDNVLL
FT                   SMNGDIKLTDFGFCAQVNDTVIKRTTMVGTPYWMAPEIVSRKEYGPKVDIWSLGIMIIE
FT                   MIEGEPPYLNETPLRALYLIATNGRPEVQEPDRLSKDFKEFIDKCLAVTVSERAESSEL
FT                   LQHKFITEVAENTEGLSALVKFSRMKKAAEQNSDSEGRSSSSSSKAVASVESGIQ"
     atgtccgctg aattaaaaag tcataaatta gaccgctcaa tcggaagtaa taaagctggt        60
     catgaacatc caattagtag gaactatgtc aataatgtcc acaatgccaa taaacataaa       120
     ctctcagact accctatgat gctgacaata acccatattg gaactagtcg tttatcatca       180
     tcatcatcgt catcatcatc atcatcatca aattcttctt cttcctcttc atactctaga       240
     gggtttatct cagataatct ttcagaatat aggtcgatgg atcccaagag cccaaataga       300
     ccagtaagat atcgctcaat tcatagcaaa tatacatcaa taagagaaga tacccaacat       360
     gaattagtta ccgacaagga ggaaattcaa aataataaag aagttagcat aaatatattg       420
     tccaaaccaa ataaacatac atccatagac tatcacaacc aaggagttga tacaacttat       480
     caaataaact cagggcaaat aagtaggcat aagcaaatgt caaagtcttt accaaataca       540
     ccaaagcctc ttcaatatca aaagagcttg agtttatcgc attcccctag aaaattgtca       600
     ttaaaatcac cctctagaaa ttttagtttt aaatcaaata gtaaacttaa tgttggcact       660
     aagcatgatc aggaaaagaa acgaccggtt aaaatgaaag aggttttttc attgtttgtt       720
     aattcaatca aggtgtccaa taatagcaat aatagtaacg atcgtagtga ccaagaagtg       780
     ccgcctaaac atgatttgaa aaaagtaaaa tcaatttcaa aaccatacaa cccgaaacat       840
     gttcatcatg ttggttttga tcctgttaca ggagattata taggcttacc agagaaatgg       900
     caagctcttc ttgagtcaaa tggtattact aagaaagagc aggaaaaaga tattaagacg       960
     ctacttaatg ttgtccaatt ttatcaagat gtttcagctt caaaaacaac ggataaactg      1020
     cttcaaacat ttccactaga aaaaggaacc atctgtgtgg atgatacaca agtatcgaca      1080
     ccgtcaaata taacaagtag tgccgatgat gatgccgcca aaccttcctt taatgagagt      1140
     ttgatgcctg caatctcaat tgaaagtcgg cataaaaacg aagtaaacca actaattttg      1200
     aaggaaagct tttctactga agacaaattc atcccaagta gaccagcccc aaagccacca      1260
     gcattacagg aattaaaagc tattcctccc aagtctccca accgtccgaa ggccactcga      1320
     gtgaaaaata actcatcaaa aataacgtca gttaattctc ttcctaataa tggcgaacca      1380
     actgttcaat ttagtaatga tcagaaatcg cataaatcac aacgggttgg aacttccaca      1440
     gatacattta ggttcgaaaa atctcttagc ggcaataaaa aaacaatttc gattacaagt      1500
     acaagtacca gcacatccaa acaccctaca aactataggg aatcttgggg aataaaaggt      1560
     cacacagata aaaaagaaaa ctcgaatgtt attaagagag atgaaggaaa taagaaagca      1620
     gagaaagaca aacgaatgca agttgtgcta tcgagattat ctaaaatttg tacaccagga      1680
     acacctgagg ataaatttga aacataccta aaaattggtc aaggtgcttc gggtggtgta      1740
     tatttatctc attccagaag cgataagtcc cagtgtgtag ctatcaaaca gatgaacttg      1800
     gagaaacaac caaagaagga gctaattgta aatgaaatca tggtaatgag ctcaagtaaa      1860
     catcaaaata ttgtaaacta tattgactca tacttatctg gtcttgattt atgggttgta      1920
     atggagtaca tggaaggtgg ctgtcttact gatgttgtaa cttattgcgt tcttacggaa      1980
     ggtcagatag gtgctgtgtg tagagaagta ttacaaggtt tagaattcct acattcgaaa      2040
     ggggtccttc atcgggacat aaagtcagat aatgtcctac tttcaatgaa tggagatatt      2100
     aaactaactg attttggatt ttgcgctcaa gtcaatgata ctgtaataaa aagaacaacc      2160
     atggtgggca ctccgtactg gatggcccct gaaattgtat cacgtaagga gtacggtcca      2220
     aaagttgata tttggtcttt aggcatcatg ataatagaaa tgatcgaggg cgaaccgcct      2280
     tatctaaatg agactccgct gagggcattg tatttaattg cgacaaacgg ccgtcctgaa      2340
     gtgcaagaac ctgatagatt gagcaaagac ttcaaagagt tcattgataa atgcctggct      2400
     gtcactgtaa gtgaaagagc ggaatcatcg gaattgctgc aacataaatt cataactgaa      2460
     gtggccgaga atacagaagg tttatccgcc ctggtgaaat tttctagaat gaaaaaagct      2520
     gcagagcaaa atagtgattc ggaagggcgt tccagcagtt catcttcaaa agctgttgct      2580
     tctgttgaat cagggataca atag                                             2604
//

If you have problems or comments...

PBIL Back to PBIL home page