(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE444

CAGLA1_12.PE444      Location/Qualifiers
FT   CDS_pept        complement(1014414..1018844)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142004" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440118"
FT                   /locus_tag="CAGL0M10175g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="acid-amino acid ligase activity"
FT                   /function="binding"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62767.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="HOGENOM:HBG058164"
FT                   /db_xref="HOGENOM:HBG202351"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B7192"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ05"
FT                   /transl_table=1
FT                   /translation="MDDHSTDYEMDDHYTDGEEDEVQYVYPDGEEEDSDDDGLGDDYDG
FT                   EGDGMFHSLDEDEDHEGVEDDIDEEIDGDGFDVEGAIPAAFGGRRVRVATQPAMNLQEL
FT                   LGTLSQHMGQAQQNRRNTTNAGDTSTPPANATFSDFISMFSSRMAREGGTGSRNSRMVK
FT                   LVENIANASEDSYIAMESLREISENLLMTNQLLLDRIIPMDELLVAVIDILKDPMLSQE
FT                   SELQVQACRCLHNLYEVNIDSMSSSVDQNIIQILQDKLQQIDFIDLAEQVLETLEYLSR
FT                   IQGKDICRNGEMSIYIRYYDFFTVHAQRKAVYIVTNALTNAIEADFVNIKEVFPSLTQI
FT                   FMNTNDSNVISHILNAYTGVCRNIKNSDQLVSLFLPSLFDKILQILSNVDSQLEDKLKC
FT                   INIMTLLVSQCLDLKRHFLRREEPVQDIMLCLNVYAKNNSTKINDKLMFVPKKLLLSVT
FT                   RFITALLPSEEDSLLSNNVLTEVEIDGSNIYLDRIFKDLTPLLIELYGNTTDFEMKEYV
FT                   LVCMARISTHTKQTDVQKLCKHLLPCLASILSHIQNNDLLATSLDNIISDKQMEQWILC
FT                   TATLSILRILLNKFGDVVANSMKREGINIMINSISEKVKEFTGLNLRSIELKHVSHDNN
FT                   EDESSDSDSANNEDNYDISVPDYVKPKAIKFNLLSYPSPEKTLKYLELYCDELTDIAPL
FT                   YRTNSNEELDSIKQTINFMADIEVETFDAEKCDKLWRMLYSNIFGNDEELSGFEMISTG
FT                   LGKAVATLLEQLSNNYQIRKSFEKIFSSKAINLVTLLQSTLNRVENFPIIDSGISGESG
FT                   VSLLTKLLKLELVIDENLEELGLPKNLETTNVQIHCIATYTNLKDFIKQRFLKVQFLDN
FT                   LLPNSSIRNNESNPNSADALDSLLKEKNMEFYFEDYQIDSNDTIFGGLLKAYEKLDKSI
FT                   RDVWQKSQRIKVKFVSKSDKFEETQGDEKESISRMKSSTPADHDDPALDILKILKFLHN
FT                   CSISAENFVNTKLSSKLARQLDEPLIVLSIRLPEWATLLTKEFSFLFPFETRMFALQCI
FT                   SFDQGRLIQLWKSRVDSSSKINTDEQLEHLGRVVRHKLRIPRKDMFSTGVKVLKRFGGD
FT                   STVMEVEYIDEVGTGLGPTLEFYAIISKEFARKSLNMWHCLDDNMKHVADGTPNDNTMS
FT                   EVYVLNPLFPAPMIPEEKKRDEVLDLFNQLGVFVARSLYDNRILDFRFNPVFFMLCHAI
FT                   TKNEGLSTLTLDSDQVYQQLSILANIDSQLAASLRYIYNNRTNTPLIKSLSLTFTLPGY
FT                   NFELVEHGNDHAVDDLTSVEKYISLVLDMFLGTGIAPQLNSFIDGFSRLFPYKNMLLFS
FT                   PNEIADLFGRVEEDWSPETLFTYLVADHGYTMDSPTIRDLISIISTFDNQEKRMFLQFL
FT                   TGSPKLPLGGFKSLKPKLTVVLKHAEDGLQPDDYLPSVMTCANYLKLPKYSSREVMRQQ
FT                   ILTAMTEGADSFQLS"
     atggatgatc atagcactga ctatgagatg gacgaccatt acaccgatgg cgaagaagat        60
     gaagtgcagt atgtttatcc agatggagaa gaagaagata gtgatgatga cgggctagga       120
     gatgactatg atggagaggg agatgggatg tttcatagcc ttgatgaaga tgaggatcat       180
     gaaggagtag aagacgatat agatgaagaa atagatggag atggctttga tgttgaaggt       240
     gccataccgg ctgctttcgg aggaagaagg gtccgagtgg caactcagcc agcgatgaat       300
     ttacaggaac ttttgggaac tttatctcaa cacatgggtc aagcacaaca aaatagacgt       360
     aataccacca atgcagggga tacatctaca ccaccagcaa atgcaacctt ttctgatttc       420
     atcagtatgt tcagtagccg tatggcgagg gaaggaggaa caggatccag aaactctaga       480
     atggtaaaac tggtggaaaa tattgccaat gcttcagaag atagttatat tgccatggaa       540
     agtttgagag agatatcaga gaatcttttg atgacaaatc agctactgtt agacagaatt       600
     ataccgatgg atgagctact tgttgctgtg attgatatat taaaagatcc aatgctatca       660
     caagaatctg aacttcaagt acaggcctgt agatgtctac acaaccttta tgaggtcaat       720
     attgatagca tgtcttcatc ggttgatcaa aatatcattc agatattaca agataagcta       780
     cagcaaattg attttattga ccttgcagaa caggttttag agacattaga atacctatcg       840
     cggattcaag gaaaagatat ttgccgaaac ggtgaaatga gtatatacat cagatactat       900
     gattttttta ctgttcatgc tcaaagaaaa gcggtataca tagtcactaa tgcactaact       960
     aatgctattg aagctgactt tgtaaacatt aaggaggtgt ttccttcatt aactcaaata      1020
     ttcatgaaca ccaatgattc aaatgttata agtcatattc tgaacgctta tactggtgtt      1080
     tgtagaaata ttaaaaattc tgatcaacta gtttcactgt ttttgcctag tctttttgat      1140
     aaaatcctac aaattctatc caatgttgac agccaacttg aagataaatt gaaatgcata      1200
     aatatcatga ccttgttagt atctcagtgc ctggatctta agagacactt tttaagaaga      1260
     gaggagcccg ttcaagacat tatgctttgc ctaaacgttt atgctaagaa taactctaca      1320
     aagattaatg acaagcttat gtttgttcca aagaagttgc ttcttagtgt cactagattt      1380
     ataacagctc tacttccttc tgaagaagat agtttactct ccaataatgt tttaacagag      1440
     gtagaaatag acggaagcaa catatatctg gacagaatat ttaaggactt gacacctttg      1500
     ctaatagagc tctacggaaa tacaaccgat tttgagatga aggaatatgt tcttgtttgt      1560
     atggcaagaa tatcaactca tacaaaacaa acagatgttc aaaagttgtg taaacatctc      1620
     cttccatgtt tagcttctat tttgtcacat attcaaaaca atgatctatt agctacttca      1680
     ttggacaata taataagcga taagcaaatg gaacaatgga tcttatgcac ggctacatta      1740
     agcatattga ggatattact caacaaattt ggtgatgttg ttgcaaattc aatgaaaaga      1800
     gaaggcataa atattatgat aaattcaata tctgagaaag tgaaagaatt tacaggtctt      1860
     aacttacgtt caattgaatt gaaacatgta tcacacgaca acaacgaaga tgagagtagt      1920
     gatagtgata gcgcaaataa tgaagacaac tacgatattt ctgttcccga ctacgtaaaa      1980
     cctaaagcga tcaagtttaa ccttttgtct tatccatcac cagaaaaaac actcaaatac      2040
     ttggaactat attgcgacga acttactgat attgcaccgt tatatagaac caattcaaat      2100
     gaagagttag attccatcaa acaaacaatc aattttatgg cagatattga agttgaaaca      2160
     tttgatgctg aaaaatgtga taaattgtgg agaatgctct attcaaatat ttttggaaac      2220
     gatgaagaac tatccggatt tgaaatgatt tcaacagggt tgggaaaagc agttgctaca      2280
     cttttagagc agttaagtaa caattaccag attagaaaat catttgaaaa aattttcagc      2340
     tccaaagcca ttaaccttgt gactttacta caaagtacac tcaatagggt tgagaatttc      2400
     cctattattg atagtggcat ctctggcgag agtggtgttt cattattaac caaattactc      2460
     aagctagaat tggtaataga tgagaattta gaggaattag gtttacccaa gaatttggaa      2520
     actacaaacg tacaaattca ttgtattgca acatatacaa acttaaagga ttttataaaa      2580
     cagagatttt taaaagttca atttcttgat aacctacttc caaattcttc aataaggaat      2640
     aacgaatcta atccgaatag tgcggatgca ttagattctt tactaaagga aaaaaacatg      2700
     gagttttact ttgaagatta tcaaattgat tcaaacgaca ccatttttgg agggttacta      2760
     aaggcttatg aaaaacttga taaatctatc agagatgtat ggcaaaagtc ccaaagaata      2820
     aaggtaaagt ttgtctccaa atctgacaaa tttgaagaaa cacaggggga cgaaaaagaa      2880
     agtattagca gaatgaagtc ttcaactccc gcggaccatg acgacccagc acttgatata      2940
     ctcaaaatat taaagttcct gcacaactgt tcaataagtg ccgaaaattt tgtgaacaca      3000
     aaattaagct ctaaactagc cagacaattg gacgaacctt tgattgtttt aagtattcgt      3060
     ctacccgaat gggctactct gctaactaaa gaattctcct ttttatttcc ttttgaaact      3120
     agaatgtttg ctcttcagtg catttctttt gatcaaggta gattaatcca attatggaag      3180
     tccagagttg attcttcaag caaaattaac actgacgagc aattagaaca cttgggtaga      3240
     gttgttagac ataaactgag aatccctaga aaagacatgt tctcaactgg tgtcaaggtt      3300
     ctgaagaggt ttggtggtga ttctacagtt atggaagttg agtatattga tgaggttgga      3360
     actggccttg gaccaacgct ggaattttat gctatcatat caaaagaatt tgctcgcaag      3420
     tcattgaaca tgtggcactg cctagatgat aacatgaagc acgttgctga cggtactcca      3480
     aatgataata caatgtctga ggtttacgtg ctaaacccac tatttccagc accaatgata      3540
     cccgaagaaa aaaaaagaga tgaagtttta gatttattca atcaattggg tgtatttgtt      3600
     gctcgttcgc tgtatgataa tagaattctg gatttccgtt tcaaccctgt attttttatg      3660
     ttatgccatg caattaccaa aaatgaaggt ctaagcacat tgacgttgga ttcagatcaa      3720
     gtataccagc aattgtcaat attagccaac atagactccc aattggcagc ttctttgagg      3780
     tacatataca acaacagaac aaatactcct ttaataaaat ctctgtcact tacgtttacg      3840
     ttaccggggt ataacttcga attagttgaa catggtaatg atcatgctgt tgatgatttg      3900
     acgtctgttg aaaaatatat ttcattggta ttagatatgt ttctgggcac tggtattgct      3960
     ccacagttga atagttttat tgatggattt tcgaggctat ttccttacaa aaatatgctt      4020
     ttattttccc cgaatgaaat agctgatctg tttggaaggg tcgaagaaga ctggtcacca      4080
     gagacattat tcacttattt agttgctgat catggctata ccatggattc cccaactata      4140
     agggatttaa tatccattat atcaactttt gacaatcaag aaaagcgtat gttcctgcaa      4200
     tttttaacgg gctctcctaa actacctttg ggtggattca aatctttgaa gcctaaatta      4260
     acggttgttt taaaacatgc agaagatggt ctacaaccgg acgattactt acccagtgtt      4320
     atgacatgtg caaactactt aaaacttcca aaatactcaa gtagagaagt tatgagacaa      4380
     caaatcttga cagcaatgac tgaaggtgca gattcattcc aattatcata a               4431
//

If you have problems or comments...

PBIL Back to PBIL home page