(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE445

CAGLA1_12.PE445      Location/Qualifiers
FT   CDS_pept        1019623..1020342
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000177263" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196353"
FT                   /gene_name="MRT4"
FT                   /locus_tag="CAGL0M10197g"
FT                   /product="mRNA turnover protein 4 homolog "
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG62768.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG028195"
FT                   /db_xref="HOGENOM:HBG628300"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="UniParc:UPI00003B7193"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ04"
FT                   /transl_table=1
FT                   /translation="MPRSKRSKLVTLAQTDKKGRENKERIFDEVREALDTYKYVFVLQL
FT                   DDVRTPVLQEIREAWVGSKLLMGKRKVLEKALGTTREQEYKENLSKLTKYCSGVIGLLF
FT                   TNETLDTVKEYFEAYSRLDYSRPNSRAPITFEVPEGIVYSRGGQIPIEEDVPMAHSLEP
FT                   TLRNKYEMPTKIKAGKITLEAPYLVCKEGQKLDVRQALILKQFGVALAQFKVIISAYYD
FT                   NESSTVSELNINKKQDA"
     atgccaagat ctaagcgttc gaagttggtg acattagccc aaaccgataa gaagggcaga        60
     gagaacaaag agagaatttt cgatgaggtg agagaagcat tggatactta caagtatgtc       120
     tttgtgttac agttggatga tgttagaacg cctgtcttgc aagaaataag agaggcgtgg       180
     gttggttcca agttgttgat gggtaagaga aaagttttgg agaaggcgct tggtactact       240
     agagaacaag aatataagga gaatttgagt aaacttacga agtactgttc gggtgtcatt       300
     ggtctattgt ttactaatga gactcttgac actgttaagg aatatttcga ggcttactca       360
     agactggatt actcaagacc aaactctaga gcaccaatca cttttgaagt gcccgaaggt       420
     attgtttact ctcgtggtgg tcaaattccc attgaagaag atgttccaat ggcccactct       480
     ttggaaccaa cactaagaaa caagtatgag atgccaacaa agattaaggc cggtaaaatt       540
     acccttgaag ctccgtacct tgtttgtaaa gagggccaaa agttggatgt tcgtcaagcg       600
     ctaatcttga aacaatttgg tgtcgctttg gctcaattca aggttatcat ttctgcatat       660
     tacgacaatg aatcctccac cgtcagcgaa ttgaacatta ataagaaaca agatgcttga       720
//

If you have problems or comments...

PBIL Back to PBIL home page