(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE448

CAGLA1_12.PE448      Location/Qualifiers
FT   CDS_pept        1025157..1025570
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201693" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349530"
FT                   /locus_tag="CAGL0M10241g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG62770.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG166121"
FT                   /db_xref="HOGENOM:HBG499844"
FT                   /db_xref="InterPro:IPR002784"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniParc:UPI00003B7195"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ02"
FT                   /transl_table=1
FT                   /translation="MSSTTVRNSNWRLVEVGRVVLVKKGQSAGKLAAIVEIIDQKQVLI
FT                   DGPETGVPRQSINLGQVVLTPLTFTLPRGARTSIVSKKWAAAQVTESWKASSWAKKIAQ
FT                   RERRSALSDFERFQVMVLKKQKRYTVKKALAKA"
     atgtcttcca ctactgtcag aaactctaac tggagattgg ttgaagttgg tcgtgttgtt        60
     ttggtcaaga agggccaatc cgctggtaag ttggccgcca tcgttgaaat catcgaccaa       120
     aagcaagttt tgattgacgg tccagaaact ggtgtcccaa gacaatccat taacttgggt       180
     caagttgtct tgactccatt gaccttcact ttgccaagag gtgctagaac ttccattgtt       240
     tccaagaagt gggctgccgc tcaagttact gaatcctgga aggcttcctc ctgggctaag       300
     aagattgctc aacgtgagag acgttctgct ttgtccgact tcgaaagatt ccaagttatg       360
     gttttgaaga agcaaaagag atacactgtc aagaaggctt tggctaaggc ttaa             414
//

If you have problems or comments...

PBIL Back to PBIL home page