(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE451

CAGLA1_12.PE451      Location/Qualifiers
FT   CDS_pept        1032001..1033347
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196614" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501707"
FT                   /locus_tag="CAGL0M10307g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="catalytic activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62773.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG058159"
FT                   /db_xref="HOGENOM:HBG397262"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI00003B7198"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIZ9"
FT                   /transl_table=1
FT                   /translation="MFLKVRDWFLKDRPANHSATDLEYGWNPMESVRYLRSQYRHYKAN
FT                   PHLLSYKDVCHYTFMGSVWLFVLIMNPAPMVLKLLFYAFLTLLFLVPITSQFFFNALPI
FT                   LTWLALYFTSSYLKADIRPPITVKALPAIETVLYGDNLSDILATSTNPVLDIFAWIPYG
FT                   LFHFGAPFVVALILFLFGPPTILKGYAFAFGYMNLIGVMIQNFFPAAPPWYKILYGLES
FT                   ANYTMKGSPGGLARIDELLHINLYSNAFANSSVIFGAFPSLHSGCATMEALFFSYCFPF
FT                   LRPLFIFYVCWLWWSTMYLTHHYFVDLMAGSVLSYVIFQYTKYYHLPVVNTSYLTRWAY
FT                   PSVSKYDFKTSDPLNTDSEMHVENIPLRTYDETMSIDSRSNSNGRLELELDMDMDNMRT
FT                   VSSNTSTPASVFDRMESLSRSSATSNTSLGNLSTTDLTDPPVARKPSAF"
     atgtttctta aggtacggga ctggtttctt aaggacaggc cggctaacca tagtgctaca        60
     gatttggaat atggctggaa tcccatggag tctgtaaggt acctccggtc tcaatacaga       120
     cattataagg ctaacccaca tttattgagc tacaaggacg tgtgtcatta cacatttatg       180
     ggctctgttt ggttgtttgt gctaattatg aaccctgcac caatggttct aaagttgctg       240
     ttttatgcat tcttaactct cctgttcctg gtacccataa cttcgcagtt cttctttaat       300
     gcattgccta tcctaacctg gttggcactt tatttcactt catcatactt aaaggcagat       360
     attagaccac ctatcacagt caaggcgttg cctgctattg aaacagtgct atacggtgat       420
     aacttgagtg atatcctagc aacatccacc aatcctgttt tggatatttt cgcatggatc       480
     ccatacggtc tgttccactt tggtgcacct ttcgtggtag cgttgatttt gttcttgttc       540
     ggtccaccaa caattttgaa gggctatgca tttgcatttg gatacatgaa tctaatcggt       600
     gtcatgattc agaatttctt cccagctgct cctccttggt ataaaatcct atacggacta       660
     gagagtgcta actacaccat gaagggttcc cctggtggtt tggctagaat cgatgagcta       720
     cttcacatta acttatacag taacgcattc gctaactcct cggttatttt tggcgctttc       780
     ccatctttac actccggatg tgccaccatg gaggccttgt ttttttccta ctgcttccca       840
     tttttaagac cactatttat tttctacgtt tgctggttat ggtggtccac tatgtacttg       900
     actcatcact atttcgttga tttgatggcc ggctcagtgc tatcttatgt gattttccaa       960
     tacactaaat actatcattt gccagtggtg aatacttcct atttgacaag atgggcatac      1020
     ccaagtgtat cgaagtatga ttttaagact tctgatccgt tgaacaccga ctcagagatg      1080
     cacgtcgaga atattccatt aagaacttac gatgaaacaa tgagtatcga ctctaggagt      1140
     aacagcaatg gtagacttga gttggagtta gatatggata tggataatat gcgtactgta      1200
     agcagcaaca cttctacacc agcatcggtt tttgatagaa tggaatcttt atccaggtcg      1260
     tccgcaactt caaatacatc attgggaaat ttgtccacaa ctgacttgac tgaccctcct      1320
     gtagcaagaa agccatctgc attctag                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page