(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE46

CAGLA1_12.PE46       Location/Qualifiers
FT   CDS_pept        complement(123429..127094)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248154" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436699"
FT                   /locus_tag="CAGL0M01144g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAG62370.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG058987"
FT                   /db_xref="HOGENOM:HBG397066"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B700C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK50"
FT                   /transl_table=1
FT                   /translation="MNVGANQVVEALNVIYSPKSNNGQRLEAQKFLDSVRTLEESPLWG
FT                   FEIALNNSDNNILKYFGLNLLEYNIKKNWNSYNNEKRQQLKKWIIELNYNVSTVDTRYI
FT                   KEKLASLWVEIAKRIWGEALKETNPSNDQLLDSWVDLDRDLHQLWNINESSREVTLIIF
FT                   RILFEDVFLLDDMTVLKRMTIIQPLCVMIVCPMDIFITKYKFSEKWTLFKADSDGWFSI
FT                   WIPELRTALLNKNSEYIIRLLETLKTCLNWPLSEVIIKNDILTTLLDCLATDIRKAQSM
FT                   ALDSIHILLTRPYGNDEHYQTIIDKVFDSMDLLARVYEDLLFNPEEEVDETRYPIVKKF
FT                   VDMTSCLYVSIPKIKDTNNQIEKYFKLVMQTTYNPSLIVSGLTLDLWCSCLRNDDYIPL
FT                   IQKYAIKDLLNFAADALVYYEQIDGHISRNYVDIDFQSNSEFQSYCSTYRKRIRDIIRL
FT                   ISCVEIDMTYEWLNNRLNVYFSSPAGQQVLTSSFLDHKSEPYLGALSQYMIVECFINGC
FT                   IRWKIWYPSGPDYNQKLDSILQKLEILSNQLIALNMKEPLLLKKQIQNFALFLTMLRDN
FT                   VLFTLLEKIITSATMDYPEVNLDDRSEQSDAVRDLRYACGIELNRMALLMPESLKSIYP
FT                   DLEAVIAKIMPNLSYHEKISFKSFLLIIVLKSSLDNKEQRFSELVDVELMAWSEKTTEV
FT                   GLSDLHWFMERLGIVQIAEYFQKRGINENSDLLTIPIDDEGRALKAELTKRWQTLFPVR
FT                   ATRMFIHYSMQSIKGDEEFKRLQDLWRPRIIPVLPYILRLLFQLQSYHDAENWKNLPVI
FT                   VQTFVKCTTVERFWEAGASSKSKDEFIDEHMKAMQTLRDFADSVGHIIRYTREYTLLVL
FT                   SAISSLGSIFFELDDVPDMLINSIAIFKPGNNEISPGVSTHGWKHILNIAIRPMLKNCP
FT                   DDCAPKFMSAFLPKLFEMLDHLLYQRWSVRMDVMDVNPAPVDNDQMTEDILEENLLRQL
FT                   TTVVVRIVIDCVGQASVSSQSARSNLTSHQLRMRKIIFNDINILAPFLKLVNHLMAYKD
FT                   NKCSFNSILVMKGCINEVAAKDETVDVFFTTELMKNLLINVLCNSAFKDFFNEALYVFT
FT                   TLFLTLCKESTSARQFFYELSGGYDIDSLHSNLKKVDDYKSQRALMVEFIDWTKMTLGK
FT                   DDFDEEQAMQENRKQEKREAILQKANERLIKKNKESGDMLDDPNTEDGAVGNLFS"
     atgaatgtcg gggctaatca agttgttgag gcacttaatg taatatattc ccctaaatca        60
     aataatgggc agaggttaga ggctcaaaaa tttttagaca gcgttcgaac attggaagaa       120
     tcccctcttt gggggtttga aattgcttta aacaacagtg ataacaatat tttgaaatac       180
     tttggattga accttttgga atacaatatt aaaaaaaatt ggaattcgta taataatgaa       240
     aagagacaac aattgaaaaa atggataatt gaactaaact ataatgttag tactgttgat       300
     accagataca taaaggagaa gttggccagt ctttgggttg aaattgcaaa gagaatttgg       360
     ggtgaagcgc tgaaggaaac aaacccaagc aacgatcagc ttttggattc ttgggtggat       420
     ttagataggg atttacacca attgtggaac atcaatgaat caagtagaga agtaacccta       480
     atcatcttcc gtattttatt tgaagatgtg tttctgttag atgatatgac ggtattgaaa       540
     agaatgacca ttatacagcc tctatgtgtg atgatcgtgt gcccgatgga catttttatc       600
     accaaataca aattcagtga gaaatggact ttatttaaag ctgatagcga tggctggttc       660
     tcaatttgga taccagaact gcgtactgct ttgttgaaca agaattcaga gtacatcatt       720
     aggttattgg aaacattaaa aacttgtctg aactggccat taagtgaagt aataataaag       780
     aatgatattc tgactactct attggactgc cttgccacag atatacgaaa agctcaatca       840
     atggctctcg attctattca catcttattg actaggccgt atggtaacga cgaacattat       900
     caaaccatta tagataaagt atttgatagt atggatcttt tggctagagt atatgaagat       960
     cttttgttta atcctgagga agaagttgat gaaacaagat accctattgt aaagaaattt      1020
     gtcgatatga ccagttgttt gtatgtatca ataccaaaaa ttaaagacac aaacaatcag      1080
     attgaaaaat acttcaaatt agtcatgcaa acaacatata atccaagttt gattgttagt      1140
     ggtttgacgt tggatttatg gtgctcgtgt ctaagaaatg atgactacat ccccttgatc      1200
     caaaagtatg ccattaagga tttattgaat tttgcagcag atgctttagt ttactacgaa      1260
     caaatagatg gtcatatatc aagaaattat gttgatattg atttccaatc aaactctgaa      1320
     tttcaatcat attgttctac atatagaaaa agaatcagag atatcataag gctgatttca      1380
     tgtgttgaaa ttgatatgac atatgaatgg ttaaacaata gactaaatgt ctatttcagt      1440
     tctcctgctg gtcaacaggt gctgacctca tctttcttag atcataaatc agaaccatat      1500
     ttgggtgccc tatctcagta tatgatagta gagtgcttta taaacggttg tataagatgg      1560
     aagatttggt atccaagtgg accagactac aatcaaaagt tggactctat cttacagaaa      1620
     ctggaaattc tttccaatca attgatagcg ttaaacatga aagagccatt acttttgaag      1680
     aagcaaattc agaacttcgc cttattctta acaatgctga gagacaatgt tctattcaca      1740
     ttgttggaga aaattattac aagtgcaact atggactacc cagaagtcaa cttggatgat      1800
     aggtcagaac aatcagatgc tgtccgtgat ttaagatatg cttgtggtat agaattgaat      1860
     agaatggccc tactaatgcc cgaatccttg aagtctatct atcctgatct ggaagcagta      1920
     atagctaaga ttatgccaaa cttgtcatat cacgaaaaga tatcattcaa atcatttcta      1980
     ttaattattg ttttgaaatc tagcttggat aataaagagc aaagattctc ggaattggtg      2040
     gatgtagagt taatggcatg gtctgagaag acaacagagg taggattgtc tgacttgcat      2100
     tggtttatgg aaagattagg gatagttcag atagcagaat acttccaaaa aagaggtata      2160
     aatgagaata gcgacttgtt gactattcca attgatgatg aaggaagggc tttgaaagca      2220
     gaattaacta aaagatggca aacattattt ccagttagag caactaggat gtttattcat      2280
     tattcaatgc agagcattaa aggtgatgaa gaatttaaac gtttgcagga tttatggaga      2340
     ccgcgaatta ttccagttct accatacatt ctaagattac tttttcaatt acaatcgtat      2400
     catgatgcag aaaactggaa aaacttgcca gttattgtac aaacttttgt caaatgtacc      2460
     acagttgaaa gattctggga agcaggtgcc tctagtaaat ccaaggatga attcattgat      2520
     gagcatatga aagctatgca aactttgcgt gattttgcag actcggttgg tcatattata      2580
     agatacacta gagaatatac attattggtt cttagcgcaa tatcttcttt gggtagtata      2640
     ttttttgaat tagatgatgt tcctgatatg cttattaact caattgccat tttcaaacca      2700
     gggaataatg aaattagtcc tggtgtatca acacatggtt ggaaacacat tttaaacatt      2760
     gcaattagac caatgttgaa aaattgtccc gatgactgtg ccccaaaatt tatgagtgct      2820
     tttttaccca aattgtttga gatgctagat catctgcttt accagcgttg gtctgtaaga      2880
     atggatgtca tggacgtaaa ccccgctcct gtagataatg atcaaatgac agaagatata      2940
     ttggaagaaa atctgttgag acaactaaca acagttgttg ttcgaattgt cattgattgt      3000
     gttggacaag caagtgtcag ctcacaaagt gctcgcagta atctcacttc acatcaattg      3060
     agaatgagaa agattatttt caatgatata aatatcttgg caccgttctt aaaattggtc      3120
     aaccatttga tggcttacaa agataacaaa tgttctttta actctatctt agtgatgaaa      3180
     ggttgcataa atgaagttgc ggcaaaggat gaaactgtag atgtgttctt tactacagaa      3240
     ttgatgaaga acctgctcat aaatgtgcta tgtaacagtg ctttcaaaga tttcttcaac      3300
     gaggctttat acgttttcac tacattattc ctcactctct gtaaagagag cacgtcagca      3360
     aggcaattct tctatgaatt atcgggtggt tatgatattg atagcctgca tagcaatctg      3420
     aaaaaagtag atgactacaa aagtcaaaga gccctcatgg ttgagtttat tgattggaca      3480
     aagatgactc ttggaaaaga tgattttgac gaggaacagg caatgcaaga aaatagaaag      3540
     caagaaaaac gtgaagctat tcttcagaaa gccaatgaac ggttaattaa aaagaataaa      3600
     gaaagtggtg acatgttgga tgatccaaac actgaggatg gagctgttgg taatctattt      3660
     tcttga                                                                 3666
//

If you have problems or comments...

PBIL Back to PBIL home page