(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE47

CAGLA1_12.PE47       Location/Qualifiers
FT   CDS_pept        131016..131990
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000106048" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436700"
FT                   /locus_tag="CAGL0M01166g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="thiamine biosynthetic process "
FT                   /protein_id="CAG62371.1"
FT                   /db_xref="GO:0009228"
FT                   /db_xref="HOGENOM:HBG056531"
FT                   /db_xref="HOGENOM:HBG325902"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="UniParc:UPI00003B700D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK49"
FT                   /transl_table=1
FT                   /translation="MSATATTTTTSQLQLNSTSIEHALSDVVKTDDWSDFQFRPIREST
FT                   VSRAMTSRYFKDLDKFAVSDVVIIGCGSSGLSAAYVIAKNRPDLKIAILEANVAPGGGA
FT                   WLGGQLFSAMIMRKPADLFLKELEIPYEDEGDYVVVKHAALFTSTVLSKVLQFPNVKLF
FT                   NATAVEDLVTRPAGPNGEVSVAGVVTNWTLVTMAHDLQSCMDPNVIELSGYKEDGTRDP
FT                   SKKHGVVLSTTGHDGPFGAFSAKRIVSIDKNKKLAGMKGLDMNNAEAGVVKNSGSYNGV
FT                   GSMYFAGMEVAELEGCNRMGPTFGAMAVSGIKAGEEILKHFAE"
     atgtctgcta ctgctaccac cactacaacc tcccaattgc aattgaactc cacttcaatt        60
     gaacacgctt tgtctgatgt tgtcaagacc gatgactgga gtgacttcca attcagacca       120
     attagagaat ccactgtctc tagagccatg acctctcgtt acttcaagga cttggacaag       180
     tttgccgtct ctgatgttgt tattatcggt tgtggttcct ccggtctatc agccgcctat       240
     gtcattgcta aaaacagacc agacctaaaa atcgccattc tagaggccaa tgtcgcccca       300
     ggtggtggtg cttggttggg tggccaatta ttcagcgcca tgatcatgag aaagccagct       360
     gacttgttcc taaaggaatt ggaaattcct tatgaagatg aaggtgacta cgtagttgtc       420
     aagcacgccg ctttgttcac ctctactgtc ttgtccaagg ttctacaatt cccaaatgtt       480
     aagttgttta acgccactgc tgtcgaagac ttagttacaa gaccagctgg tccaaacggt       540
     gaagttagtg tcgccggtgt cgttacaaac tggactttgg tcaccatggc tcacgactta       600
     caaagttgta tggatccaaa cgtcatcgaa ttgtctggtt acaaggaaga tggtacccgt       660
     gacccatcaa agaagcatgg tgttgtctta tccaccactg gtcatgacgg tccattcggt       720
     gctttctcag ctaagagaat tgtttccatt gacaagaaca agaaattggc tggtatgaaa       780
     ggtctggaca tgaacaatgc cgaagcaggt gttgttaaga actctggttc ttacaatggt       840
     gttggctcta tgtactttgc tggtatggaa gttgccgagc tggaaggctg caacagaatg       900
     ggaccaacct tcggtgctat ggctgtttcc ggtatcaaag ctggtgaaga aatcttgaag       960
     cacttcgctg agtaa                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page