(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE49

CAGLA1_12.PE49       Location/Qualifiers
FT   CDS_pept        complement(137725..138729)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094409" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436701"
FT                   /gene_name="IPI1"
FT                   /locus_tag="CAGL0M01210g"
FT                   /product="Pre-rRNA-processing protein IPI1 "
FT                   /function="binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62373.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG058844"
FT                   /db_xref="HOGENOM:HBG397966"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B700F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK47"
FT                   /transl_table=1
FT                   /translation="MTKSKKQKQKKKDFLKKKLKVGKPTGKPSNSTDTSFTARTLSVRS
FT                   QLVNNAGDDLRKRLPLLKHHNDKVRKETLGIYIKAIPKIISTQLMTPLISQTSQLICDD
FT                   SKDVREQLLELFDEVGKHDEQVLKLHCRSLVLYINMGMTHILPRVQADSTKFLGCLLKY
FT                   CGQEFCDQAWNKLMAGIFRVLSWETQHSKNSNQAAGAMQTSKRDNKFQAAHLSTLYALL
FT                   ECGCKEPTVETTDEDTTSNIQNFEEVQYMTPSFPQAYGYLKLFDKQLKSSSSNKDNSSV
FT                   SSSDALDVESRIRNVENVYLPTMKKQIEQIIQEGGEAGKNANNIKKLISEIFS"
     atgacaaagt ctaagaaaca aaaacaaaag aagaaggatt ttttgaagaa gaagcttaaa        60
     gttggtaaac ccactggtaa gcctagtaat agtacagaca cttcttttac tgctaggact       120
     ttatcggtta gaagtcaact ggtgaataat gctggcgacg atctgcgaaa gagattaccg       180
     ctgctgaaac atcataacga taaagtacgt aaggaaacat tgggaatata tataaaagca       240
     attccgaaga taattagtac acagctaatg acaccgttaa tttcccaaac ttcgcaactt       300
     atatgtgatg actcaaagga cgttagagag caattgctgg aactgtttga tgaggtagga       360
     aaacatgatg aacaagtgct caagttacat tgcagatcat tagtgctgta tataaacatg       420
     ggtatgactc atattttgcc gagagtgcag gcagattcaa caaaatttct aggttgtctt       480
     ttgaaatact gtggccaaga gttttgcgat caggcttgga ataagttaat ggctggtata       540
     ttcagagtgc tatcatggga aactcagcac agcaagaact ccaaccaagc tgctggagca       600
     atgcaaacca gtaaaagaga caacaagttt caagctgccc acctttccac actatatgcg       660
     ttgcttgagt gtggttgtaa agaaccaaca gtggagacaa cagatgaaga cacaacgagc       720
     aatattcaaa attttgagga ggtacaatat atgacaccta gtttcccaca agcatatggc       780
     tacctaaaac ttttcgataa gcaactgaag tcttcctcca gcaataaaga taactcttca       840
     gttagtagtt cagatgcctt agatgttgaa tctaggataa gaaatgtaga gaacgtctac       900
     ttacctacta tgaagaagca aatagagcaa attatacaag aaggcggaga ggctggaaaa       960
     aacgctaaca atataaagaa actgataagc gagatctttt cctag                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page