(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE5

CAGLA1_12.PE5        Location/Qualifiers
FT   CDS_pept        28137..30434
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157526" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435639"
FT                   /locus_tag="CAGL0M00220g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="mannosyltransferase activity"
FT                   /biological_process="protein O-linked glycosylation "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62330.1"
FT                   /db_xref="GO:0000030"
FT                   /db_xref="GO:0006493"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG026546"
FT                   /db_xref="HOGENOM:HBG328830"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR003608"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="UniParc:UPI00003B6FE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK90"
FT                   /transl_table=1
FT                   /translation="MAVTKRSPGTKKFGSSASKESSVDVDDVSLKYNKGVAATEQLAQN
FT                   WLLNPKPDSDNSYRLGFYLVTAIAFAVRFYKIYYPREVVFDEVHFGKFASYYLERTFFF
FT                   DVHPPLAKMMIAFIGWLCNYDGSFKFEEIGLSYDKHPAPFLAYRSFNALLGTLTVSIMF
FT                   ESMKELNFKAITCFLASMLVAIDNAHVTETRLILLDAILLISVAATVYSYIRFYKLQLK
FT                   EPFSWNWYIWLYLTGFSLSCVISTKYIGVMTYAAIGIPVVVNLWQLLDINAKLSIRMLI
FT                   KHIGRRLNGLILIPFIIYLFWFYVHFAILNVSGPGDVFMSSEFQDTLHDSEATKLSKEV
FT                   QFFDIVTFENQDTGAFLHSHLARYPLRYEDDRVSSQGQQVTCYTHEDVNNQWEILPVAD
FT                   KAKGDNIRFGDEFRLRHVGTDSYLLAHDVASPLYPTNEEITTVHKDDALGARANSTIFR
FT                   FQPINKKDEGHIIKSKNAVLRIIHKETVVALWSHNDELLPDWGFGQQEVNGNKKMTDSG
FT                   NAWTIDSIMNLDEKRSAYAPKEIKSMPFFNKWLELQKLMFEQNNKLTSEHPFASQPESW
FT                   PGSMSGVSFWTKNEERRQIYFIGNIIGFWFQVISFAVYVGIIIADQITRQRGYFALNKV
FT                   TREKLYGPLAYLFCGWACHYFPFFLMGRQKFLHHYLPAHLIAALFAAGLWETVFSRCKS
FT                   DDPYKDEEKPGVSFEKYPAIYTAAYITFNITVLAALVWCFVFFSPLIYATPLSAREVIK
FT                   RKWLDISLSFAK"
     atggcagtta ccaagcggtc tcctggaact aagaaatttg gctcaagcgc ctctaaggag        60
     tcctcagtgg atgtggacga tgtatctttg aaatacaaca aaggcgttgc tgccacagag       120
     caactcgctc agaattggtt gctgaaccct aaaccggact ctgataatag ttacaggctt       180
     ggtttttact tagtcacagc cattgctttt gcagtgagat tctataagat ttactatcct       240
     cgtgaagtgg tcttcgatga agtacacttc ggaaagtttg cttcctatta tttggagagg       300
     acattctttt tcgatgttca tcctcctttg gctaagatga tgattgcttt catcggttgg       360
     ctatgtaact acgacggctc cttcaagttt gaagaaatcg gattgagtta cgacaagcac       420
     cctgcacctt tcttagcgta ccgttcattt aatgctttac tgggcacttt gactgtatct       480
     atcatgtttg aatctatgaa ggaattgaac tttaaggcca taacctgctt ccttgcatca       540
     atgctagtcg ctattgacaa cgcccatgta accgagacta gattgatttt attggatgcc       600
     attttgttaa tttcggttgc tgcaactgtt tactcttaca ttagattcta taaactacag       660
     ttgaaagaac cattttcttg gaactggtac atttggttgt acttgactgg tttctccttg       720
     tcctgtgtta tctcgactaa atatattggt gtgatgacgt atgcagctat cgggattcct       780
     gtggtggtta acttgtggca attgttggat attaacgcaa aactttcaat caggatgttg       840
     atcaaacata taggtagaag attgaacggg ttgattctta tcccattcat tatttacctc       900
     ttttggtttt acgtccactt tgccattttg aatgtttcgg gacccggtga cgttttcatg       960
     tcttctgagt ttcaagatac tcttcatgac tctgaagcta caaagctatc taaagaagtt      1020
     caattcttcg atatcgttac ctttgagaat caagacacag gtgctttcct acattcgcac      1080
     cttgctcgtt acccattacg ttatgaggat gatagagtct cctcccaggg acaacaggtt      1140
     acatgttata cgcatgaaga cgttaataat caatgggaaa ttcttccagt tgcagacaag      1200
     gccaaaggtg ataatataag atttggtgat gaatttagat tgagacatgt tggaactgac      1260
     tcttatttgt tagctcatga tgttgcatct ccactttacc ccacaaatga ggaaattact      1320
     acagttcaca aagacgatgc cttgggagca agagcaaact ctaccatttt tagatttcaa      1380
     ccaattaaca agaaagatga gggtcatatc ataaaatcaa aaaacgcagt cttacgtata      1440
     attcataaag agactgtcgt agctctatgg tctcacaatg atgagcttct acctgattgg      1500
     ggtttcggac aacaagaagt caatggtaat aagaaaatga cggactctgg taacgcctgg      1560
     acaatcgaca gtatcatgaa tctagatgaa aagagaagtg cttatgctcc taaagaaatc      1620
     aagagcatgc ctttctttaa caaatggtta gaactacaaa agttaatgtt cgagcagaat      1680
     aataaactga cgtctgagca tccttttgct tcccagcccg aatcatggcc cggaagtatg      1740
     tctggtgttt cattctggac taaaaatgaa gagaggcgcc aaatttactt cattggtaac      1800
     attattggtt tctggttcca ggttattagt ttcgctgttt atgtaggaat aatcattgct      1860
     gatcaaatta caagacaacg tggttacttt gccttgaaca aggttaccag ggaaaaacta      1920
     tatggtccat tagcgtacct attctgtggt tgggcttgtc attatttccc attctttttg      1980
     atgggtcgtc agaagtttct gcatcactat ttgccagcac atttgattgc agcactattt      2040
     gccgcgggtc tgtgggaaac cgtttttagt agatgtaaat ctgacgaccc atacaaagat      2100
     gaggaaaagc caggtgttag ttttgagaaa tacccagcta tttacactgc tgcttatatt      2160
     acatttaaca tcactgttct ggcagctttg gtttggtgtt ttgtattctt ttctcctctg      2220
     atttacgcta ctccactaag tgctagagaa gtaatcaaga gaaaatggtt agatatttca      2280
     ttgagttttg ctaaataa                                                    2298
//

If you have problems or comments...

PBIL Back to PBIL home page